Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9sphn-q0kjt3

Sphingomonas sp., Sphingobium wenxiniae 3-oxoaipate enol-lactone hydrolase

Comment
Other strains: Sphingomonas sp., Sphingobium wenxiniae (strain DSM 21828 / JZ-1)


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Sphingomonas sp. KA1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Sphingomonas: N E > Sphingomonas sp. KA1: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AB270530, KJ009324
2 UniProt : Q0KJT3, A0A059U332
2 UniProt : Q0KJT3, A0A059U332
2 Interpro : Q0KJT3, A0A059U332
2 Prodom : Q0KJT3, A0A059U332
2 Pfam : Q0KJT3, A0A059U332
2 PIRSF : Q0KJT3, A0A059U332
2 SUPERFAM : Q0KJT3, A0A059U332
Sequence
Graphical view for this peptide sequence: 9sphn-q0kjt3
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MEKQFIITGDGCRIAYRFDGKEGAPILLLSNSLGTDMQMWEPQLAAWSAH
FRMLRYDQRGHGASDAPVGGYSLDRLGRDVIELLDQLEIETIDFCGLSLG
GMTGQWLGIREGHRVRRLVLANTSSFMGPPSAWDARIALVRESGMAPLTS
ASLERWFTADFVASSPDAIAPIVAMLQSTDSQGYAGCCAAIRDMDMRSTI
ALIRNETLIIGGSQDPATPPPHSEALAATIPRCRLAMLNTAHLANVERPA
EFGTQVSDFLRAETVVGIDSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKQFIITGDGCRIAYRFDGKEGAPILLLSNSLGTDMQMWEPQLAAWSAH
FRMLRYDQRGHGASDAPVGGYSLDRLGRDVIELLDQLEIETIDFCGLSLG
GMTGQWLGIREGHRVRRLVLANTSSFMGPPSAWDARIALVRESGMAPLTS
ASLERWFTADFVASSPDAIAPIVAMLQSTDSQGYAGCCAAIRDMDMRSTI
ALIRNETLIIGGSQDPATPPPHSEALAATIPRCRLAMLNTAHLANVERPA
EFGTQVSDFLRAETVVGIDSL


References
3 more
    Title: The Sphingomonas plasmid pCAR3 is involved in complete mineralization of carbazole
    Shintani M, Urata M, Inoue K, Eto K, Habe H, Omori T, Yamane H, Nojiri H
    Ref: Journal of Bacteriology, 189:2007, 2007 : PubMed

            

    Title: Divergent structures of carbazole degradative car operons isolated from gram-negative bacteria
    Inoue K, Widada J, Nakai S, Endoh T, Urata M, Ashikawa Y, Shintani M, Saiki Y, Yoshida T and Nojiri H <2 more author(s)>
    Ref: Biosci Biotechnol Biochem, 68:1467, 2004 : PubMed

            

    Title: Sphingomonas sp. strain KA1, carrying a carbazole dioxygenase gene homologue, degrades chlorinated dibenzo-p-dioxins in soil
    Habe H, Ashikawa Y, Saiki Y, Yoshida T, Nojiri H, Omori T
    Ref: FEMS Microbiology Letters, 211:43, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer