Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9sphn-q2pfa3

Sphingomonas sp. KA1 meta cleavage compound hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Sphingomonas sp. KA1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Sphingomonas: N E > Sphingomonas sp. KA1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AB220949, AB270530
1 UniProt : Q2PFA3
1 UniProt : Q2PFA3
1 Interpro : Q2PFA3
1 Prodom : Q2PFA3
1 Pfam : Q2PFA3
1 PIRSF : Q2PFA3
1 SUPERFAM : Q2PFA3
Sequence
Graphical view for this peptide sequence: 9sphn-q2pfa3
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MQTVQEAGRRADAGGIDTFYLEEGAGPPIVLIHGGGAGADSWGNWRNVIP
HLSSDRRVIAVDMVGFGHTAKPNGDFVYSQPARVRHMIAFLDALDVGPAT
LVGNSMGGATAIGVAVERPDLVSKLILMGSAGLVTRIDPALAPILKYDFT
REGMVRLVRALTTDSFRIDDEMIDYRYELSVQDDTRRAYSATMAWIAEQG
GLFWEEDYIRRISVPTLVVNGKCDKVVPVGQAYRFLELIDNSWGYLIPDC
GHWAMIEHPDDFARITRSFADA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTVQEAGRRADAGGIDTFYLEEGAGPPIVLIHGGGAGADSWGNWRNVIP
HLSSDRRVIAVDMVGFGHTAKPNGDFVYSQPARVRHMIAFLDALDVGPAT
LVGNSMGGATAIGVAVERPDLVSKLILMGSAGLVTRIDPALAPILKYDFT
REGMVRLVRALTTDSFRIDDEMIDYRYELSVQDDTRRAYSATMAWIAEQG
GLFWEEDYIRRISVPTLVVNGKCDKVVPVGQAYRFLELIDNSWGYLIPDC
GHWAMIEHPDDFARITRSFADA


References
1 more
    Title: Plasmid pCAR3 contains multiple gene sets involved in the conversion of carbazole to anthranilate
    Urata M, Uchimura H, Noguchi H, Sakaguchi T, Takemura T, Eto K, Habe H, Omori T, Yamane H, Nojiri H
    Ref: Applied Environmental Microbiology, 72:3198, 2006 : PubMed

            

    Title: Divergent structures of carbazole degradative car operons isolated from gram-negative bacteria
    Inoue K, Widada J, Nakai S, Endoh T, Urata M, Ashikawa Y, Shintani M, Saiki Y, Yoshida T and Nojiri H <2 more author(s)>
    Ref: Biosci Biotechnol Biochem, 68:1467, 2004 : PubMed

            

    Title: Sphingomonas sp. strain KA1, carrying a carbazole dioxygenase gene homologue, degrades chlorinated dibenzo-p-dioxins in soil
    Habe H, Ashikawa Y, Saiki Y, Yoshida T, Nojiri H, Omori T
    Ref: FEMS Microbiology Letters, 211:43, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer