Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9tele-a0a1a8gt06

Nothobranchius korthausae (Turquoise killifish, bluefin notho); N. furzeri; N. kadleci; N. korthausae; N. pienaari; N rachovii, Kynurenine formamidase

Comment
Other strains: Nothobranchius korthausae (Turquoise killifish, bluefin notho); Nothobranchius furzeri; Nothobranchius kadleci; Nothobranchius korthausae; Nothobranchius pienaari; Nothobranchius rachovii


Relationship
Family|Kynurenine-formamidase
Block| H
Position in NCBI Life Tree|Nothobranchius korthausae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Ovalentaria: N E > Atherinomorphae: N E > Cyprinodontiformes: N E > Aplocheiloidei: N E > Nothobranchiidae: N E > Nothobranchius: N E > Nothobranchius korthausae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9tele-a0a1a8gt06
Colored MSA for Kynurenine-formamidase (raw)
MAERLTGISVNQELEKQYSPSRWSHRMAADDVIKAHVKALKEGTARARGL
AQTLLDVPYGDGDGEKVDVYIPSTNSLDVNLVVYIHGGYWQFLSKEESGF
MAVPLVGKGVVVVAVGYDIAPKGDMDLMVSQVRRSVVSVVQQYSHISGLY
LCGHSAGAHLAAMVLSTDWSQHSLAPQIKGAFLVSGIYDLLPILPTYVNE
PLKMTEEVAVRNSPSRLVPQLKLSSSSCQIVVAVAENDSPEFRKQSKEYF
QALEAAGLNVTLEDVVNTDHFSIIEQLVNEEYHLTKLLVKMMEKS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAERLTGISVNQELEKQYSPSRWSHRMAADDVIKAHVKALKEGTARARGL
AQTLLDVPYGDGDGEKVDVYIPSTNSLDVNLVVYIHGGYWQFLSKEESGF
MAVPLVGKGVVVVAVGYDIAPKGDMDLMVSQVRRSVVSVVQQYSHISGLY
LCGHSAGAHLAAMVLSTDWSQHSLAPQIKGAFLVSGIYDLLPILPTYVNE
PLKMTEEVAVRNSPSRLVPQLKLSSSSCQIVVAVAENDSPEFRKQSKEYF
QALEAAGLNVTLEDVVNTDHFSIIEQLVNEEYHLTKLLVKMMEKS



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer