Gene_locus Report for: 9tele-a0a1a8gt06Nothobranchius korthausae (Turquoise killifish, bluefin notho); N. furzeri; N. kadleci; N. korthausae; N. pienaari; N rachovii, Kynurenine formamidase Comment Other strains: Nothobranchius korthausae (Turquoise killifish, bluefin notho); Nothobranchius furzeri; Nothobranchius kadleci; Nothobranchius korthausae; Nothobranchius pienaari; Nothobranchius rachovii Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Ovalentaria: N E > Atherinomorphae: N E > Cyprinodontiformes: N E > Aplocheiloidei: N E > Nothobranchiidae: N E > Nothobranchius: N E > Nothobranchius korthausae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Nothobranchius furzeri: N, E.
Nothobranchius kadleci: N, E.
Nothobranchius pienaari: N, E.
Nothobranchius rachovii: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
>3 UniProt links 4 more: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72<7 UniProt links 4 less: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72, A0A1A8GT06, A0A1A8QRR8, A0A1A8RRG1, A0A1A8S871>3 Interpro links 4 more: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72<7 Interpro links 4 less: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72, A0A1A8GT06, A0A1A8QRR8, A0A1A8RRG1, A0A1A8S871>3 Pfam links 4 more: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72<7 Pfam links 4 less: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72, A0A1A8GT06, A0A1A8QRR8, A0A1A8RRG1, A0A1A8S871>3 PIRSF links 4 more: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72<7 PIRSF links 4 less: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72, A0A1A8GT06, A0A1A8QRR8, A0A1A8RRG1, A0A1A8S871>3 SUPERFAM links 4 more: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72<7 SUPERFAM links 4 less: A0A1A8ARH1, A0A1A8CEH8, A0A1A8DR72, A0A1A8GT06, A0A1A8QRR8, A0A1A8RRG1, A0A1A8S871
|
Sequence Graphical view for this peptide sequence: 9tele-a0a1a8gt06
Colored MSA for Kynurenine-formamidase (raw)
MAERLTGISVNQELEKQYSPSRWSHRMAADDVIKAHVKALKEGTARARGL
AQTLLDVPYGDGDGEKVDVYIPSTNSLDVNLVVYIHGGYWQFLSKEESGF
MAVPLVGKGVVVVAVGYDIAPKGDMDLMVSQVRRSVVSVVQQYSHISGLY
LCGHSAGAHLAAMVLSTDWSQHSLAPQIKGAFLVSGIYDLLPILPTYVNE
PLKMTEEVAVRNSPSRLVPQLKLSSSSCQIVVAVAENDSPEFRKQSKEYF
QALEAAGLNVTLEDVVNTDHFSIIEQLVNEEYHLTKLLVKMMEKS
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MAERLTGISVNQELEKQYSPSRWSHRMAADDVIKAHVKALKEGTARARGL
AQTLLDVPYGDGDGEKVDVYIPSTNSLDVNLVVYIHGGYWQFLSKEESGF
MAVPLVGKGVVVVAVGYDIAPKGDMDLMVSQVRRSVVSVVQQYSHISGLY
LCGHSAGAHLAAMVLSTDWSQHSLAPQIKGAFLVSGIYDLLPILPTYVNE
PLKMTEEVAVRNSPSRLVPQLKLSSSSCQIVVAVAENDSPEFRKQSKEYF
QALEAAGLNVTLEDVVNTDHFSIIEQLVNEEYHLTKLLVKMMEKS
|
|
|
|
