Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-6XYC

Beaver gut metagenome acetyl xylan esterase BD-FAE bifunctional feruloyl and acetyl xylan esterase active on complex natural xylans

Comment
Penttinen, L., Hameleers, L., Hakulinen, N., Master, E., Jurak, E.


Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|gut metagenome
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> unclassified sequences: N E > metagenomes: N E > organismal metagenomes: N E > gut metagenome: N E


Molecular evidence
Database
No mutation
2 structures: 6TKX, 6XYC
No kinetic





No Substrate
No inhibitor
2 Structure : 6TKX, 6XYC
Sequence
Graphical view for this peptide sequence: 9zzzz-6XYC
Colored MSA for BD-FAE (raw)
KGPAEDTYSTSWTNVNYASDSLESHNLDIYLPKEQKTAYKAIIIIYGSAW
FANNAKAMASASIGAPLLKAGFAVISINHRSSMEAIWPAQIQDVKAAIRY
VRSNAAKYNIDPSFIGITGFSSGGHLSAFAGVTNGVKTLTSGDLTVDIEG
SLGNYLSTGSHVDAVVDWFGPVDMAHMSNCVAPNDASTPEAVLIGKKDPR
EEPDWVKLISPINFVDKDDPDILIIHGDADNVVPHCQSVNLKNVYDNAGA
KATFISVPGGGHGPGCFDTQYFKDMTDFFTEQSTKLE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KGPAEDTYSTSWTNVNYASDSLESHNLDIYLPKEQKTAYKAIIIIYGSAW
FANNAKAMASASIGAPLLKAGFAVISINHRSSMEAIWPAQIQDVKAAIRY
VRSNAAKYNIDPSFIGITGFSSGGHLSAFAGVTNGVKTLTSGDLTVDIEG
SLGNYLSTGSHVDAVVDWFGPVDMAHMSNCVAPNDASTPEAVLIGKKDPR
EEPDWVKLISPINFVDKDDPDILIIHGDADNVVPHCQSVNLKNVYDNAGA
KATFISVPGGGHGPGCFDTQYFKDMTDFFTEQSTKLE


Reference
    Title: Polysaccharide utilization loci-driven enzyme discovery reveals BD-FAE: a bifunctional feruloyl and acetyl xylan esterase active on complex natural xylans
    Hameleers L, Penttinen L, Ikonen M, Jaillot L, Faure R, Terrapon N, Deuss PJ, Hakulinen N, Master ER, Jurak E
    Ref: Biotechnol Biofuels, 14:127, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer