Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-AncHLDRLuc2

Synthetic construct of the common ancestor of haloalkane dehalogenases and Renilla luciferase with fragment transplabntation (Anc-FT) AncFT

Comment
Luciferase from Renilla reniformis (RLuc) catalyzes the degradation of coelenterazine in the presence of molecular oxygen, resulting in the product coelenteramide, carbon dioxide, and the desired photon of light (EC 1.13.12.5). This enzyme belongs to the Haloalkane dehalogenase family II with a different catalytic function (EC 3.8.1.5) Reconstruction of the ancestral enzyme shows it has both hydrolase and monooxygenase activities ( Chaloupkova et al.) Preprint available of: Engineering Protein Dynamics of Ancestral Luciferase DOI: 10.26434/chemrxiv.12808295


Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|synthetic construct
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> other sequences: N E > artificial sequences: N E > synthetic construct: N E


Molecular evidence
Database
No mutation
3 structures: 6S97, 7QXQ, 7QXR
No kinetic





No Substrate
No inhibitor
3 Structure : 7QXQ, 7QXR, 6S97
Sequence
Graphical view for this peptide sequence: 9zzzz-AncHLDRLuc2
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
ATGDEWWAKCKQVDVLDSEMSYYDSDPGKHKNTVIFLHGNPTSSYLWRNV
IPHVEPLARCLAPDLIGMGKSGKLPNHSYRFVDHYRYLSAWFDSVNLPEK
VTIVCHDWGSGLGFHWCNEHRDRVKGIVHMESVVDVIESWDEWPDIEEDI
ALIKSEAGEEMVLKKNFFIERLLPSSIMRKLSEEEMDAYREPFVEPGESR
RPTLTWPREIPIKGDGPEDVIEIVKSYNKWLSTSKDIPKLFINADPGFFS
NAIKKVTKNWPNQKTVTVKGLHFLQEDSPEEIGEAIADFLNELT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ATGDEWWAKCKQVDVLDSEMSYYDSDPGKHKNTVIFLHGNPTSSYLWRNV
IPHVEPLARCLAPDLIGMGKSGKLPNHSYRFVDHYRYLSAWFDSVNLPEK
VTIVCHDWGSGLGFHWCNEHRDRVKGIVHMESVVDVIESWDEWPDIEEDI
ALIKSEAGEEMVLKKNFFIERLLPSSIMRKLSEEEMDAYREPFVEPGESR
RPTLTWPREIPIKGDGPEDVIEIVKSYNKWLSTSKDIPKLFINADPGFFS
NAIKKVTKNWPNQKTVTVKGLHFLQEDSPEEIGEAIADFLNELT


References
    Title: A catalytic mechanism for Renilla-type bioluminescence
    Schenkmayerova A, Toul M, Pluskal D, Baatallah R, Gagnot G, Pinto GP, Santana VT, Stuchla M, Neugebauer P and Marek M <5 more author(s)>
    Ref: Biorxiv, :, 2022 : PubMed

            

    Title: Light-Emitting Dehalogenases: Reconstruction of Multifunctional Biocatalysts
    Chaloupkova, R, Liskova V, Tool M, Markova K, Sebestova E, Hernychova L, Marek M, Pinto GP, Pluskal D and Damborsky J <2 more author(s)>
    Ref: ACS Catal, 9:4810, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer