Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-CE1.6RZN

anaerobic digester metagenome CE1 of multi-enzyme CE1-GH62-GH10 wtsFae1B

Comment
mutidomain enzyme consisting of three catalytic domains: ferulic acid esterase, arabinofuranosidase, and xylanase CE1-GH62-GH10. Here only N-terminal carbohydrate binding module family 48 and ferulic acid esterase (CE1) from the multi-enzyme CE1-GH62-GH10


Relationship
Family|A85-Feruloyl-Esterase
Block| X
Position in NCBI Life Tree|anaerobic digester metagenome
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> unclassified sequences: N E > metagenomes: N E > ecological metagenomes: N E > anaerobic digester metagenome: N E


Molecular evidence
Database
No mutation
3 structures: 6RZN, 8BBP, 8BF3
No kinetic





No Substrate
No inhibitor
1 UniProt : A0A5S8WFA0
3 Structure : 6RZN, 8BF3, 8BBP
1 UniProt : A0A5S8WFA0
1 Interpro : A0A5S8WFA0
1 Pfam : A0A5S8WFA0
1 PIRSF : A0A5S8WFA0
1 SUPERFAM : A0A5S8WFA0
Sequence
Graphical view for this peptide sequence: 9zzzz-CE1.6RZN
Colored MSA for A85-Feruloyl-Esterase (raw)
QVTPRPEAAPGARPGFRAPARIISPEIMPDNKVTFRVYSKDASKVTITGE
WQTGPGGVEELVKNDTGMFSITVGPLKPELYAYNFTVDGVKALDANNVQV
RRDGTNYQNFFIIPGPESDLYFHKNNVPHGTVTKVWYKSSVIGFDRRMYV
YTPAGYEGDTQRYPVFYLLHGAGGDEDAWTNMGRTAQIMDNLIAQGKAKP
MIVVMTNGNANQAGAQNEVPPVPVTQGQQGIPSGSGMTGKFEEHLVKDVV
PFIEKNFRALTGKDNRAIAGLSMGGGHTQTITNDNPGMFSYIGVFSMGIM
AGRQQGADAEKIEKERDAKIEALKKSGYKLYWIACGKDDFVYQSALTLRN
TLDKHNFKYVYRESTGGHTWANWRIYLSEFAPMLFK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

QVTPRPEAAPGARPGFRAPARIISPEIMPDNKVTFRVYSKDASKVTITGE
WQTGPGGVEELVKNDTGMFSITVGPLKPELYAYNFTVDGVKALDANNVQV
RRDGTNYQNFFIIPGPESDLYFHKNNVPHGTVTKVWYKSSVIGFDRRMYV
YTPAGYEGDTQRYPVFYLLHGAGGDEDAWTNMGRTAQIMDNLIAQGKAKP
MIVVMTNGNANQAGAQNEVPPVPVTQGQQGIPSGSGMTGKFEEHLVKDVV
PFIEKNFRALTGKDNRAIAGLSMGGGHTQTITNDNPGMFSYIGVFSMGIM
AGRQQGADAEKIEKERDAKIEALKKSGYKLYWIACGKDDFVYQSALTLRN
TLDKHNFKYVYRESTGGHTWANWRIYLSEFAPMLFK


References
    Title: Enzymatic Cleavage of Diferuloyl Cross-Links in Corn Bran Arabinoxylan by Two Bacterial Feruloyl Esterases
    Lin S, Brask J, Munk L, Holck J, KBRM, Meyer AS, Agger JW, Wilkens C
    Ref: Journal of Agricultural and Food Chemistry, 70:133349, 2022 : PubMed

            

    Title: A carbohydrate-binding family 48 module enables feruloyl esterase action on polymeric arabinoxylan
    Holck J, Fredslund F, Moller MS, Brask J, Krogh K, Lange L, Welner DH, Svensson B, Meyer AS, Wilkens C
    Ref: Journal of Biological Chemistry, 294:17339, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer