Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-DAC80243

anaerobic digester metagenome CE1 of multi-enzyme CE1-GH62-GH10 wtsFae1A

Comment
mutidomain enzyme consisting of three catalytic domains: ferulic acid esterase, arabinofuranosidase, and xylanase CE1-GH62-GH10. Here only N-terminal carbohydrate binding module family 48 and ferulic acid esterase (CE1) from the multi-enzyme CE1-GH62-GH10


Relationship
Family|A85-Feruloyl-Esterase
Block| X
Position in NCBI Life Tree|anaerobic digester metagenome
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> unclassified sequences: N E > metagenomes: N E > ecological metagenomes: N E > anaerobic digester metagenome: N E


Molecular evidence
Database
No mutation
1 structure:
6RZO: Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 wtsFae1A
No kinetic





No Substrate
No inhibitor
2 Genbank : DAC80243, BK010417
1 Structure : 6RZO
Sequence
Graphical view for this peptide sequence: 9zzzz-DAC80243
Colored MSA for A85-Feruloyl-Esterase (raw)
MEDFKPTSTNQPGRQYPQVNSEGRVRARIEAPQAHTVLLDIGGVRYPMTQ
GEDGAWIGDSRPQDEGFHYYQLVIDGARVPDPGSLYFFGANRWGSGVEVP
AHDQDFYAIKDVPHGRVQKILFPSGSTSTIRRAFVYTPPDYGKDLSKRYP
VLYLQHGWGEDETGWANQGRVNLIMDNLIAEGKARPFIIVMTYGMTNEIR
FGGIREFDIRPFQTVLVDELIPYIDANFRTRSDQPHRAMAGLSMGGMETR
LITMNNLDLFSHIGLFSGGTISASDITDRDVFKQKIKLVFVSCGSRENPG
RFRPAVDSLQQAGISAVSYVSPDTAHEWQTWRRSFYQFAQLLFQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEDFKPTSTNQPGRQYPQVNSEGRVRARIEAPQAHTVLLDIGGVRYPMTQ
GEDGAWIGDSRPQDEGFHYYQLVIDGARVPDPGSLYFFGANRWGSGVEVP
AHDQDFYAIKDVPHGRVQKILFPSGSTSTIRRAFVYTPPDYGKDLSKRYP
VLYLQHGWGEDETGWANQGRVNLIMDNLIAEGKARPFIIVMTYGMTNEIR
FGGIREFDIRPFQTVLVDELIPYIDANFRTRSDQPHRAMAGLSMGGMETR
LITMNNLDLFSHIGLFSGGTISASDITDRDVFKQKIKLVFVSCGSRENPG
RFRPAVDSLQQAGISAVSYVSPDTAHEWQTWRRSFYQFAQLLFQ


References
    Title: Novel xylanolytic triple domain enzyme targeted at feruloylated arabinoxylan degradation
    Holck J, Djajadi DT, Brask J, Pilgaard B, Krogh K, Meyer AS, Lange L, Wilkens C
    Ref: Enzyme Microb Technol, 129:109353, 2019 : PubMed

            

    Title: A carbohydrate-binding family 48 module enables feruloyl esterase action on polymeric arabinoxylan
    Holck J, Fredslund F, Moller MS, Brask J, Krogh K, Lange L, Welner DH, Svensson B, Meyer AS, Wilkens C
    Ref: Journal of Biological Chemistry, 294:17339, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer