Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-Ple629

Marinobacter Hydrolase (PETase-like) Cold-Adapted PET Hydrolase Ple629

Comment
Sequence not yet available.


Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|metagenome
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)


Molecular evidence
Database
No mutation
2 structures: 7VPA, 7VPB
No kinetic





5 substrates (e.g. : 3-PBT, BETEB, BHBT... more)
2 inhibitors: BTa, MHETA
1 Genbank : OK558825
2 Structure : 7VPA, 7VPB
Sequence
Graphical view for this peptide sequence: 9zzzz-Ple629
Colored MSA for Polyesterase-lipase-cutinase (raw)
MGGGGSGGGNNGGGGGCEADCGYERGPDPSVSLLEASTGPFSVRTSNVSS
SVRGFGGGTIHYPTNTTGTMAAIVVIPGFVSPESSIAWWGPKLASHGFVV
MTIGTNSGFDQPASRASQLNNALDYLIEQNGSSRSPINGMIDTDRLGVMG
WSMGGGGTLRVATEGRVSAAIPLAPWDSSSSQFRSIDTPTLIFACENDST
APVRSHADPFYDAIPDSTAKAFVELDGGGHTCANGSSGFGGSYNDVLSRL
GVSWMKLHLDKDQRYNQFVCGPNHESDRSISEYRGTCPYLE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGGGGSGGGNNGGGGGCEADCGYERGPDPSVSLLEASTGPFSVRTSNVSS
SVRGFGGGTIHYPTNTTGTMAAIVVIPGFVSPESSIAWWGPKLASHGFVV
MTIGTNSGFDQPASRASQLNNALDYLIEQNGSSRSPINGMIDTDRLGVMG
WSMGGGGTLRVATEGRVSAAIPLAPWDSSSSQFRSIDTPTLIFACENDST
APVRSHADPFYDAIPDSTAKAFVELDGGGHTCANGSSGFGGSYNDVLSRL
GVSWMKLHLDKDQRYNQFVCGPNHESDRSISEYRGTCPYLE


References
    Title: Structural insight and engineering of a plastic degrading hydrolase Ple629
    Li Z, Zhao Y, Wu P, Wang H, Li Q, nGao J, Qin HM, Wei H, Bornscheuer UT and Liu W <2 more author(s)>
    Ref: Biochemical & Biophysical Research Communications, 626:100, 2022 : PubMed

            

    Title: Molecular and Biochemical Differences of the Tandem and Cold-Adapted PET Hydrolases Ple628 and Ple629, Isolated From a Marine Microbial Consortium
    Meyer-Cifuentes IE, Wu P, Zhao Y, Liu W, Neumann-Schaal M, Pfaff L, Barys J, Li Z, Gao J and Ozturk B <3 more author(s)>
    Ref: Front Bioeng Biotechnol, 10:930140, 2022 : PubMed

            

    Title: Synergistic biodegradation of aromatic-aliphatic copolyester plastic by a marine microbial consortium
    Meyer-Cifuentes IE, Werner J, Jehmlich N, Will SE, Neumann-Schaal M, zturk B
    Ref: Nat Commun, 11:5790, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer