Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-a0a2k8jn75

uncultured bacterium ester-hydrolase EH3 from the metagenome of marine sediments at Milazzo harbor (Sicily, Italy)

Comment
EH3 promiscuous activity 69/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
4 structures (e.g. : 6SXP, 6SXY, 6SYA... more)
No kinetic





No Substrate
No inhibitor
2 Genbank : ATW63156, KY483645
1 UniProt : A0A2K8JN75
>3 Structure links 1 more: 6SXY, 6SYA, 6SXP
1 UniProt : A0A2K8JN75
1 Interpro : A0A2K8JN75
1 Pfam : A0A2K8JN75
1 PIRSF : A0A2K8JN75
1 SUPERFAM : A0A2K8JN75
Sequence
Graphical view for this peptide sequence: 9zzzz-a0a2k8jn75
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPDTTSLNIADDVRMDPRLKAMLAAFPMMEQQTFQTREEQVANANTPEAT
AAREQLKMMMDMMDSEEFAPSDNLDISTREFTSSPDGNAIKIQFIRPKGK
QKVPCVYYIHGGGMMIMSAFYGNYRAWGKMIANNGVAVAMVDFRNCLSPS
SAPEVAPFPAGLNDCVSGLKWVSENADELSIDKNKIIIAGESGGGNLTLA
TGLKLKQDGNIDLVKGLYALCPYIAGKWPQDRFPSSSENNGIMIELHNNQ
GALAYGIEQLEAENPLAWPSFASAEDMQGLPPTVINVNECDPLRDEGIDF
YRRLMAAGVPARCRQVMGTCHAGDMFVAVIPDVSADTAADIARTAKGG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPDTTSLNIADDVRMDPRLKAMLAAFPMMEQQTFQTREEQVANANTPEAT
AAREQLKMMMDMMDSEEFAPSDNLDISTREFTSSPDGNAIKIQFIRPKGK
QKVPCVYYIHGGGMMIMSAFYGNYRAWGKMIANNGVAVAMVDFRNCLSPS
SAPEVAPFPAGLNDCVSGLKWVSENADELSIDKNKIIIAGESGGGNLTLA
TGLKLKQDGNIDLVKGLYALCPYIAGKWPQDRFPSSSENNGIMIELHNNQ
GALAYGIEQLEAENPLAWPSFASAEDMQGLPPTVINVNECDPLRDEGIDF
YRRLMAAGVPARCRQVMGTCHAGDMFVAVIPDVSADTAADIARTAKGG


References
    Title: Structure and evolutionary trace-assisted screening of a residue swapping the substrate ambiguity and chiral specificity in an esterase
    Cea-Rama I, Coscolin C, Katsonis P, Bargiela R, Golyshin PN, Lichtarge O, Ferrer M, Sanz-Aparicio J
    Ref: Comput Struct Biotechnol J, 19:2307, 2021 : PubMed

            

    Title: Tuning the Properties of Natural Promiscuous Enzymes by Engineering Their Nano-environment
    Giunta CI, Cea-Rama I, Alonso S, Briand ML, Bargiela R, Coscolin C, Corvini PF, Ferrer M, Sanz-Aparicio J, Shahgaldian P
    Ref: ACS Nano, :, 2020 : PubMed

            

    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer