Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9zzzz-t1bz84

mine drainage metagenome. Virulence factor family protein

Comment
Other strains: ecological metagenomes mine drainage metagenome


Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|mine drainage metagenome
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> unclassified sequences: N E > metagenomes: N E > ecological metagenomes: N E > mine drainage metagenome: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AUZY01001816
1 UniProt : T1BZ84
3 UniProt : T1BZ84, T1CCJ3, T1CJ27
3 Interpro : T1BZ84, T1CCJ3, T1CJ27
3 Pfam : T1BZ84, T1CCJ3, T1CJ27
3 PIRSF : T1BZ84, T1CCJ3, T1CJ27
3 SUPERFAM : T1BZ84, T1CCJ3, T1CJ27
Sequence
Graphical view for this peptide sequence: 9zzzz-t1bz84
Colored MSA for VirJ (raw)
MRKLRSVLLPAVLSLSLAGVAVIPRAHAAPPPIADATYGAHLINYGLFGP
VRVYQPTGIPQRAVIVFSRTTGWGANEARYATGLQQAGSLVIGVDLPRYL
KTLEALKGKCSYPAGHVEEMSHWMQKTLHLPTYLRPFIVGFDGGADFTYA
LGVQAPSGTFAGMATLGWDGQFTLPRAFCKGDAGNATVTQGKVFGFAPVT
PLPLPWLAAGSPGKNEIGPPVAFGRALRAPADGAALAAALDALVRKPVLS
AGAFADKLEDLPLTEIAPKGTSDGRVVIMFSGDGGWAGLDKGVAKVLSAH
GVRVVGLSSLEYFWHKKTPRQTAQALARILAAYTARYPDARYTLMGYSFG
AGVVPVVYNLLPPELKQHVGAEVLISPDPEGWFDIHIGDWFTTTKHQYNV
PLDPEIARTRIPVICLSGQAEGHDTYCDSLARRGMAKLVTLPGGHHYQGD
YDRLGRVILQALPR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKLRSVLLPAVLSLSLAGVAVIPRAHAAPPPIADATYGAHLINYGLFGP
VRVYQPTGIPQRAVIVFSRTTGWGANEARYATGLQQAGSLVIGVDLPRYL
KTLEALKGKCSYPAGHVEEMSHWMQKTLHLPTYLRPFIVGFDGGADFTYA
LGVQAPSGTFAGMATLGWDGQFTLPRAFCKGDAGNATVTQGKVFGFAPVT
PLPLPWLAAGSPGKNEIGPPVAFGRALRAPADGAALAAALDALVRKPVLS
AGAFADKLEDLPLTEIAPKGTSDGRVVIMFSGDGGWAGLDKGVAKVLSAH
GVRVVGLSSLEYFWHKKTPRQTAQALARILAAYTARYPDARYTLMGYSFG
AGVVPVVYNLLPPELKQHVGAEVLISPDPEGWFDIHIGDWFTTTKHQYNV
PLDPEIARTRIPVICLSGQAEGHDTYCDSLARRGMAKLVTLPGGHHYQGD
YDRLGRVILQALPR


Reference
    Title: Microbial stratification in low pH oxic and suboxic macroscopic growths along an acid mine drainage
    Mendez-Garcia C, Mesa V, Sprenger RR, Richter M, Diez MS, Solano J, Bargiela R, Golyshina OV, Manteca A and Ferrer M <7 more author(s)>
    Ref: Isme J, 8:1259, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer