Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciad-q6fas4

Acinetobacter sp. (strain ADP1) hypothetical protein

Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Acinetobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CR543861
1 UniProt : Q6FAS4
1 UniProt : Q6FAS4
1 Interpro : Q6FAS4
1 Pfam : Q6FAS4
1 PIRSF : Q6FAS4
1 SUPERFAM : Q6FAS4
Sequence
Graphical view for this peptide sequence: aciad-q6fas4
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MNQYTADILGDGYQQITLNFPDDYEGKVVATLVRKKSNINTSRAVLYIHG
FLDYFFQTQMAEQFNQHGYDFYALDLRKYGRSKLPHQIFYNVLDLKEYDA
EISAALDIIQQEQHQEILLAGHSTGGLIATLYAAHYPEQHSIRAVWVNSP
FYEFNLNFIEKKLGIPVLSQFGRVLPKFKFPSKLNRWYVTSLHHSLKGEW
AFNLDWKPKTASTVQLSFIHAIHEAQKEIHKGIKLNIPLLVMHSHQTKNP
KKWNKDATQSDVILDVKDIKKYAKKIQGDVTIQTISNGLHDLVLSATDVR
DQVYRQLFDWLDTKIS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNQYTADILGDGYQQITLNFPDDYEGKVVATLVRKKSNINTSRAVLYIHG
FLDYFFQTQMAEQFNQHGYDFYALDLRKYGRSKLPHQIFYNVLDLKEYDA
EISAALDIIQQEQHQEILLAGHSTGGLIATLYAAHYPEQHSIRAVWVNSP
FYEFNLNFIEKKLGIPVLSQFGRVLPKFKFPSKLNRWYVTSLHHSLKGEW
AFNLDWKPKTASTVQLSFIHAIHEAQKEIHKGIKLNIPLLVMHSHQTKNP
KKWNKDATQSDVILDVKDIKKYAKKIQGDVTIQTISNGLHDLVLSATDVR
DQVYRQLFDWLDTKIS


Reference
    Title: Unique features revealed by the genome sequence of Acinetobacter sp. ADP1, a versatile and naturally transformation competent bacterium
    Barbe V, Vallenet D, Fonknechten N, Kreimeyer A, Oztas S, Labarre L, Cruveiller S, Robert C, Duprat S and Medigue C <5 more author(s)>
    Ref: Nucleic Acids Research, 32:5766, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer