Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciba-a0a009wzt4

Acinetobacter baumannii; Acinetobacter nosocomialis, Acinetobacter oleivorans; Acinetobacter pittii; Acinetobacter calcoaceticus Uncharacterized protein

Comment
There are more than 800 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aciba-a0a009wzt4
Colored MSA for abh_upf00227 (raw)
MKILFLHGLDSSRESTKFHAILHPEKFCIDVDYRNLSYASVKDFYHQAIE
TIKPDLLVGHSLGGYWALKTAAQHKLAVIVANPSLTPNFRNDYPHLCDED
LDHSNPKMAYLELGDEQLDMYQVQEKLSPYMTIETYDGGHHRLAYPSRLN
DLITKIHKKYFA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKILFLHGLDSSRESTKFHAILHPEKFCIDVDYRNLSYASVKDFYHQAIE
TIKPDLLVGHSLGGYWALKTAAQHKLAVIVANPSLTPNFRNDYPHLCDED
LDHSNPKMAYLELGDEQLDMYQVQEKLSPYMTIETYDGGHHRLAYPSRLN
DLITKIHKKYFA


References
22 more
    Title: New insights into dissemination and variation of the health care-associated pathogen Acinetobacter baumannii from genomic analysis
    Wright MS, Haft DH, Harkins DM, Perez F, Hujer KM, Bajaksouzian S, Benard MF, Jacobs MR, Bonomo RA, Adams MD
    Ref: MBio, 5:e00963, 2014 : PubMed

            

    Title: Genomic insights into the fate of colistin resistance and Acinetobacter baumannii during patient treatment
    Snitkin ES, Zelazny AM, Gupta J, Palmore TN, Murray PR, Segre JA
    Ref: Genome Res, 23:1155, 2013 : PubMed

            

    Title: Complete genome analysis of three Acinetobacter baumannii clinical isolates in China for insight into the diversification of drug resistance elements
    Zhu L, Yan Z, Zhang Z, Zhou Q, Zhou J, Wakeland EK, Fang X, Xuan Z, Shen D, Li QZ
    Ref: PLoS ONE, 8:e66584, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer