Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciba-d0c661

Acinetobacter baumannii; Acinetobacter sp. SH024 Lysophospholipase

Comment
Other strains: Acinetobacter baumannii (ATCC 19606; ATCC 17978 / NCDC KC 755); Acinetobacter sp. SH024


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii ATCC 19606
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E > Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : GG704572, GG753601
1 UniProt : D0C661
1 UniProt : D0C661
1 Interpro : D0C661
1 Prodom : D0C661
1 Pfam : D0C661
1 PIRSF : D0C661
1 SUPERFAM : D0C661
Sequence
Graphical view for this peptide sequence: aciba-d0c661
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MNTSTAKHNYAPDILGAGYEQLTLNFPDDYEGKVVATLVRKKATQPTQKA
VLYIHGFLDYFFQTEMAEQFNAHGYDFYALDLRKYGRSKLPHQIFYNVLD
LNEYDAEITQALEIIGQEKHTQVLLAGHSTGGLTATLYAAHHPDHPLIKA
LWANSPFYDFNLSLVEKKFGIPMLSRVGKYLPKVKFPSQLNKWYTTSLHK
QLKGEWVFNLDWKPTSAPTVQLSFVHAIHTAQKEIHRGVKLNIPALIMHS
HQTKNPRKWGPDATQSDVILDVKDIAKFGKKMKGDVSVVSIHNGLHDLVL
SAQPVREQVYQQLFQWLDQKVT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNTSTAKHNYAPDILGAGYEQLTLNFPDDYEGKVVATLVRKKATQPTQKA
VLYIHGFLDYFFQTEMAEQFNAHGYDFYALDLRKYGRSKLPHQIFYNVLD
LNEYDAEITQALEIIGQEKHTQVLLAGHSTGGLTATLYAAHHPDHPLIKA
LWANSPFYDFNLSLVEKKFGIPMLSRVGKYLPKVKFPSQLNKWYTTSLHK
QLKGEWVFNLDWKPTSAPTVQLSFVHAIHTAQKEIHRGVKLNIPALIMHS
HQTKNPRKWGPDATQSDVILDVKDIAKFGKKMKGDVSVVSIHNGLHDLVL
SAQPVREQVYQQLFQWLDQKVT


Reference
    Title: New insights into Acinetobacter baumannii pathogenesis revealed by high-density pyrosequencing and transposon mutagenesis
    Smith MG, Gianoulis TA, Pukatzki S, Mekalanos JJ, Ornston LN, Gerstein M, Snyder M
    Ref: Genes Dev, 21:601, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer