Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciba-q76hj1

Acinetobacter baumannii, Acinetobacter sp., Acinetobacter calcoaceticus probable, acinetobactin biosynthesis protein

Comment
Other strains: Acinetobacter baumannii (strains AB0057; 1656-2; ATCC 19606 = CIP 70.34; ACICU; TCDC-AB0715; ATCC 17978 / NCDC KC 755; AB307-0294; AYE), Acinetobacter sp. SH024, Acinetobacter calcoaceticus (strain PHEA-2)


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB101202
>3 UniProt links 1 more: Q76HJ1, D0CC30, B0VBS8
>3 UniProt links 1 more: Q76HJ1, D0CC30, B0VBS8
>3 Interpro links 1 more: Q76HJ1, D0CC30, B0VBS8
>3 Pfam links 1 more: Q76HJ1, D0CC30, B0VBS8
>3 PIRSF links 1 more: Q76HJ1, D0CC30, B0VBS8
>3 SUPERFAM links 1 more: Q76HJ1, D0CC30, B0VBS8
Sequence
Graphical view for this peptide sequence: aciba-q76hj1
Colored MSA for Thioesterase (raw)
MNKPQYNMFCLPPAGSSASIYHPWKKQISDNIRIIPIEYSGHGIKINEPL
IDDPDLLAMQIANEIQAYSDTPFILFGHSVGGSLIWKVLNYLNEKTIIDQ
LRLIVISSRPEHHYIQHMRYKHELTDEKIIDELKRYNNFPDEILNNQDAL
TFFLKIIRNDLYLSDQLLGEKIHKTEVPIVAFYGKQDPDIPNKRMMDAWQ
QHTENWLGSIEFEGDHFYFLNPETRVKMLENIAAIVETLTVNIE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNKPQYNMFCLPPAGSSASIYHPWKKQISDNIRIIPIEYSGHGIKINEPL
IDDPDLLAMQIANEIQAYSDTPFILFGHSVGGSLIWKVLNYLNEKTIIDQ
LRLIVISSRPEHHYIQHMRYKHELTDEKIIDELKRYNNFPDEILNNQDAL
TFFLKIIRNDLYLSDQLLGEKIHKTEVPIVAFYGKQDPDIPNKRMMDAWQ
QHTENWLGSIEFEGDHFYFLNPETRVKMLENIAAIVETLTVNIE


References
3 more
    Title: Comparative genome sequence analysis of multidrug-resistant Acinetobacter baumannii
    Adams MD, Goglin K, Molyneaux N, Hujer KM, Lavender H, Jamison JJ, MacDonald IJ, Martin KM, Russo T and Gill SR <3 more author(s)>
    Ref: Journal of Bacteriology, 190:8053, 2008 : PubMed

            

    Title: Whole-genome pyrosequencing of an epidemic multidrug-resistant Acinetobacter baumannii strain belonging to the European clone II group
    Iacono M, Villa L, Fortini D, Bordoni R, Imperi F, Bonnal RJ, Sicheritz-Ponten T, De Bellis G, Visca P and Carattoli A <1 more author(s)>
    Ref: Antimicrobial Agents & Chemotherapy, 52:2616, 2008 : PubMed

            

    Title: Identification and transcriptional organization of a gene cluster involved in biosynthesis and transport of acinetobactin, a siderophore produced by Acinetobacter baumannii ATCC 19606T
    Mihara K, Tanabe T, Yamakawa Y, Funahashi T, Nakao H, Narimatsu S, Yamamoto S
    Ref: Microbiology, 150:2587, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer