Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciba-w3svn7

Acinetobacter baumannii; Acinetobacter sp.; Acinetobacter calcoaceticus; Acinetobacter pittii; Acinetobacter oleivorans, Alpha/beta hydrolase family protein

Comment
Other strains: Acinetobacter baumannii (CI78; 573719; 1542444; 723929; WC-136; 1289694; 883425; 1294243;225588; 1564232; WC-487; 826659; 478810; WC-141; 809848; 1245249; 1295259; 1578804; 1475718; 263903-2; 742879; 907131); Acinetobacter calcoaceticus (ANC 3680: DSM 30006 = CIP 81.8; RUH2202; ANC 3811; NIPH 13); Acinetobacter pittii (ANC 4050; CIP 70.29; 42F; ANC 4052; ANC 4052 ANC 3678); Acinetobacter oleivorans CIP 110421; Acinetobacter sp. (NIPH 817; SH024; NIPH 542)


Relationship
Family|abh_upf00227
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 35 more: AVOE01000037, JFYA01000005, JEYA01000004
>3 UniProt links 15 more: A0A013RXA8, A0A010K2V3, N9D9R1
>3 UniProt links 15 more: A0A013RXA8, A0A010K2V3, N9D9R1
>3 Interpro links 15 more: A0A013RXA8, A0A010K2V3, N9D9R1
>3 Pfam links 15 more: A0A013RXA8, A0A010K2V3, N9D9R1
>3 PIRSF links 15 more: A0A013RXA8, A0A010K2V3, N9D9R1
>3 SUPERFAM links 15 more: A0A013RXA8, A0A010K2V3, N9D9R1
Sequence
Graphical view for this peptide sequence: aciba-w3svn7
Colored MSA for abh_upf00227 (raw)
MNIIYLHGFNSSSLSIKGLSLKQYCSELGINVHLPDLNRSPDLVVEQVSK
LIESLQDVALVGSSLGGFFATYFVAKYNIPAVLINPAMQPWKLFDELFQV
ESMPYVVNDQWSIDHVQLRQLEQLELKQPENADKILVLLQQGDEILDYRQ
AQRYYSAATPSSLILTDAHGNHAMEDFEEKLPLVIEFFAHIIK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNIIYLHGFNSSSLSIKGLSLKQYCSELGINVHLPDLNRSPDLVVEQVSK
LIESLQDVALVGSSLGGFFATYFVAKYNIPAVLINPAMQPWKLFDELFQV
ESMPYVVNDQWSIDHVQLRQLEQLELKQPENADKILVLLQQGDEILDYRQ
AQRYYSAATPSSLILTDAHGNHAMEDFEEKLPLVIEFFAHIIK


References
    Title: Genome Sequences of Four Acinetobacter baumannii-A. calcoaceticus Complex Isolates from Combat-Related Infections Sustained in the Middle East
    Ketter P, Guentzel MN, Chambers JP, Jorgensen J, Murray CK, Cap AP, Yu JJ, Eppinger M, Arulanandam BP
    Ref: Genome Announc, 2:, 2014 : PubMed

            

    Title: Genome sequence of Acinetobacter calcoaceticus PHEA-2, isolated from industry wastewater
    Zhan Y, Yan Y, Zhang W, Yu H, Chen M, Lu W, Ping S, Peng Z, Yuan M and Lin M <2 more author(s)>
    Ref: Journal of Bacteriology, 193:2672, 2011 : PubMed

            

    Title: Complete genome sequence of the diesel-degrading Acinetobacter sp. strain DR1
    Jung J, Baek JH, Park W
    Ref: Journal of Bacteriology, 192:4794, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer