(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Pseudomonadales: NE > Moraxellaceae: NE > Acinetobacter: NE > Acinetobacter calcoaceticus/baumannii complex: NE > Acinetobacter baumannii: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Acinetobacter baumannii CI78: N, E.
Acinetobacter baumannii 573719: N, E.
Acinetobacter baumannii 1542444: N, E.
Acinetobacter calcoaceticus ANC 3680: N, E.
Acinetobacter calcoaceticus PHEA-2: N, E.
Acinetobacter calcoaceticus DSM 30006 = CIP 81.8: N, E.
Acinetobacter baumannii 723929: N, E.
Acinetobacter pittii ANC 4050: N, E.
Acinetobacter baumannii WC-136: N, E.
Acinetobacter sp. WC-136: N, E.
Acinetobacter baumannii 1289694: N, E.
Acinetobacter sp. DR1: N, E.
Acinetobacter oleivorans DR1: N, E.
Acinetobacter baumannii 883425: N, E.
Acinetobacter baumannii 826659: N, E.
Acinetobacter oleivorans CIP 110421: N, E.
Acinetobacter sp. NIPH 817: N, E.
Acinetobacter baumannii 1294243: N, E.
Acinetobacter pittii ANC 4052: N, E.
Acinetobacter baumannii 225588: N, E.
Acinetobacter baumannii 1564232: N, E.
Acinetobacter sp. WC-487: N, E.
Acinetobacter pittii ANC 3678: N, E.
Acinetobacter sp. SH024: N, E.
Acinetobacter sp. NIPH 542: N, E.
Acinetobacter baumannii 478810: N, E.
Acinetobacter sp. WC-141: N, E.
Acinetobacter baumannii 809848: N, E.
Acinetobacter baumannii 1245249: N, E.
Acinetobacter calcoaceticus RUH2202: N, E.
Acinetobacter baumannii 907131: N, E.
Acinetobacter calcoaceticus ANC 3811: N, E.
Acinetobacter baumannii 1295259: N, E.
Acinetobacter pittii 42F: N, E.
Acinetobacter baumannii 1578804: N, E.
Acinetobacter baumannii 1475718: N, E.
Acinetobacter baumannii 263903-2: N, E.
Acinetobacter baumannii 742879: N, E.
Acinetobacter calcoaceticus NIPH 13: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MNIIYLHGFNSSSLSIKGLSLKQYCSELGINVHLPDLNRSPDLVVEQVSK LIESLQDVALVGSSLGGFFATYFVAKYNIPAVLINPAMQPWKLFDELFQV ESMPYVVNDQWSIDHVQLRQLEQLELKQPENADKILVLLQQGDEILDYRQ AQRYYSAATPSSLILTDAHGNHAMEDFEEKLPLVIEFFAHIIK
Acinetobacter baumannii is among the most prevalent bacterial causes of combat-related infections on the battlefield. Antibiotic resistance and a poor understanding of the protective host immune responses make treatment difficult. Here, we report the genome sequences of four clinical Acinetobacter baumannii-A. calcoaceticus complex isolates exhibiting significant differences in virulence in a mouse sepsis model.
Genome analysis of Acinetobacter calcoaceticus PHEA-2 was undertaken because of the importance of this bacterium for bioremediation of phenol-polluted water and because of the close phylogenetic relationship of this species with the human pathogen Acinetobacter baumannii. To our knowledge, this is the first strain of A. calcoaceticus whose genome has been sequenced.
Title: Complete genome sequence of the diesel-degrading Acinetobacter sp. strain DR1 Jung J, Baek JH, Park W Ref: Journal of Bacteriology, 192:4794, 2010 : PubMed
The genus Acinetobacter is ubiquitous in soil, aquatic, and sediment environments and includes pathogenic strains, such as A. baumannii. Many Acinetobacter species isolated from various environments have biotechnological potential since they are capable of degrading a variety of pollutants. Acinetobacter sp. strain DR1 has been identified as a diesel degrader. Here we report the complete genome sequence of Acinetobacter sp. DR1 isolated from the soil of a rice paddy.
Acinetobacter baumannii Non-ribosomal peptide synthetase (thioesterase domain)