Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acibt-a3m5x2

Acinetobacter baumannii, Acinetobacter calcoaceticus (strains PHEA-2; RUH2202) 3-oxoadipate enol-lactonase I PcaD

Comment
There are more than 600 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: acibt-a3m5x2
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MKQTISNRQGKQLAVYTDCLKDAPVLVFSNSLGTDHGMWQPQLNELKSHF
NVITYDTRGHGESDVISDTTLQNLAEDVVDILDALNIEKAHFCGISMGGI
TGLWLGIHHPNRFNSITVANSAAKIGQTEAWLSRAESVEQNGLAELVKTT
HTRWFSEKFDYQHNVVAQTTIQSLANTPAQGYANACCALAYADLRDEIAQ
IQIPTLLIAGTEDPVTTVADAEFMQKAINNSQLAKLEASHLSNIEQPQRF
TQELTRFIQQI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKQTISNRQGKQLAVYTDCLKDAPVLVFSNSLGTDHGMWQPQLNELKSHF
NVITYDTRGHGESDVISDTTLQNLAEDVVDILDALNIEKAHFCGISMGGI
TGLWLGIHHPNRFNSITVANSAAKIGQTEAWLSRAESVEQNGLAELVKTT
HTRWFSEKFDYQHNVVAQTTIQSLANTPAQGYANACCALAYADLRDEIAQ
IQIPTLLIAGTEDPVTTVADAEFMQKAINNSQLAKLEASHLSNIEQPQRF
TQELTRFIQQI


References
4 more
    Title: Genome sequence of a dominant, multidrug-resistant Acinetobacter baumannii strain, TCDC-AB0715
    Chen CC, Lin YC, Sheng WH, Chen YC, Chang SC, Hsia KC, Liao MH, Li SY
    Ref: Journal of Bacteriology, 193:2361, 2011 : PubMed

            

    Title: Whole-genome comparison of two Acinetobacter baumannii isolates from a single patient, where resistance developed during tigecycline therapy
    Hornsey M, Loman N, Wareham DW, Ellington MJ, Pallen MJ, Turton JF, Underwood A, Gaulton T, Thomas CP and Woodford N <2 more author(s)>
    Ref: J Antimicrob Chemother, 66:1499, 2011 : PubMed

            

    Title: New insights into Acinetobacter baumannii pathogenesis revealed by high-density pyrosequencing and transposon mutagenesis
    Smith MG, Gianoulis TA, Pukatzki S, Mekalanos JJ, Ornston LN, Gerstein M, Snyder M
    Ref: Genes Dev, 21:601, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer