Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acica-DCH

Acinetobacter calcoaceticus F46 Acinetobacter baumannii (strain ACICU) dihydrocoumarin hydrolase lactonohydrolase (EC 3.1.1.35)

Relationship
Family|Haloperoxidase
Block| X
Position in NCBI Life Tree|Acinetobacter calcoaceticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter calcoaceticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
3,4-Dihydrocoumarin
No inhibitor
3 Genbank : AB092339, AY743585, CP000863
1 UniProt : Q5XPN1
2 UniProt : Q83WC8, Q5XPN1
2 Interpro : Q83WC8, Q5XPN1
2 Prodom : Q83WC8, Q5XPN1
2 Pfam : Q83WC8, Q5XPN1
2 PIRSF : Q83WC8, Q5XPN1
2 SUPERFAM : Q83WC8, Q5XPN1
Sequence
Graphical view for this peptide sequence: acica-DCH
Colored MSA for Haloperoxidase (raw)
MGYVTTKDGVDIFYKDWGPRDAPVIFFHHGWPLSSDDWDAQMLFFLKEGF
RVVAHDRRGHGRSTQVWDGHDMDHYADDVAAVVEYLGVQGAVHVGHSTGG
GEVAYYVARYPNDPVAKAVLISAVPPLMVKTESNPDGLPKEVFDDLQNQL
FKNRSQFYHDVPAGPFYGFNRPGAKVSEPVVLNWWRQGMMGGAKAHYDGI
VAFSQTDFTEALKKIEVPVLILHGEDDQVVPFEISGKKSAELVKNGKLIS
YPGFPHGMPTTEAETINKDLLAFIRS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGYVTTKDGVDIFYKDWGPRDAPVIFFHHGWPLSSDDWDAQMLFFLKEGF
RVVAHDRRGHGRSTQVWDGHDMDHYADDVAAVVEYLGVQGAVHVGHSTGG
GEVAYYVARYPNDPVAKAVLISAVPPLMVKTESNPDGLPKEVFDDLQNQL
FKNRSQFYHDVPAGPFYGFNRPGAKVSEPVVLNWWRQGMMGGAKAHYDGI
VAFSQTDFTEALKKIEVPVLILHGEDDQVVPFEISGKKSAELVKNGKLIS
YPGFPHGMPTTEAETINKDLLAFIRS


References
    Title: Whole-genome pyrosequencing of an epidemic multidrug-resistant Acinetobacter baumannii strain belonging to the European clone II group
    Iacono M, Villa L, Fortini D, Bordoni R, Imperi F, Bonnal RJ, Sicheritz-Ponten T, De Bellis G, Visca P and Carattoli A <1 more author(s)>
    Ref: Antimicrobial Agents & Chemotherapy, 52:2616, 2008 : PubMed

            

    Title: Role of Acinetobacter calcoaceticus 3,4-dihydrocoumarin hydrolase in oxidative stress defence against peroxoacids
    Honda K, Kataoka M, Sakuradani E, Shimizu S
    Ref: European Journal of Biochemistry, 270:486, 2003 : PubMed

            

    Title: 3,4-Dihydrocoumarin hydrolase with haloperoxidase activity from Acinetobacter calcoaceticus F46
    Kataoka M, Honda K, Shimizu S
    Ref: European Journal of Biochemistry, 267:3, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer