Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acica-d0ryi9

Acinetobacter calcoaceticus, Acinetobacter sp. Putative uncharacterized protein

Comment
Other strains: Acinetobacter calcoaceticus (RUH2202; PHEA-2), Acinetobacter sp. (strains JCM 1667 / KCTC 23045 / DR1; SH024)


Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Acinetobacter calcoaceticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter calcoaceticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: GG704949, CP002080, GG753600
3 UniProt : D0RYI9, D8JIU0, F0KFQ3
3 UniProt : D0RYI9, D8JIU0, F0KFQ3
3 Interpro : D0RYI9, D8JIU0, F0KFQ3
3 Prodom : D0RYI9, D8JIU0, F0KFQ3
3 Pfam : D0RYI9, D8JIU0, F0KFQ3
3 PIRSF : D0RYI9, D8JIU0, F0KFQ3
3 SUPERFAM : D0RYI9, D8JIU0, F0KFQ3
Sequence
Graphical view for this peptide sequence: acica-d0ryi9
Colored MSA for abh_upf0017 (raw)
MDMGISTLNKIKAFGSELFDSVLGAEQPKVYYDPQGKIKDVLDKLPQLKQ
KYRPTPWLSNNHVHLLYFDIIRKKTIKLEYDRIDQLTMKDGGVTAIAWYG
YNLPKTTPTVVIMHTITGTPESMRELVKDLHHYTGWRIALCLRRGHAGLP
MPVPQISLFGSTSDLKEQLTHIQNLFPESDLYAVGSSAGTGLLVRYLGEQ
GTDTPFKAAFAMCPGYNTEIGFKNVHPFYSKMMTKKLFKYFIHPYQSTWN
KISSLEKVLATTSLEEFEKEYFEMAGFQDYQSYCQAINPIYVFENVKIPL
MILNAEDDPVCSIKNLEPYKEKIQQMSNIAVVTTKKGSHCGFYEGWKSTS
WAAKLISNYFMVNHKQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDMGISTLNKIKAFGSELFDSVLGAEQPKVYYDPQGKIKDVLDKLPQLKQ
KYRPTPWLSNNHVHLLYFDIIRKKTIKLEYDRIDQLTMKDGGVTAIAWYG
YNLPKTTPTVVIMHTITGTPESMRELVKDLHHYTGWRIALCLRRGHAGLP
MPVPQISLFGSTSDLKEQLTHIQNLFPESDLYAVGSSAGTGLLVRYLGEQ
GTDTPFKAAFAMCPGYNTEIGFKNVHPFYSKMMTKKLFKYFIHPYQSTWN
KISSLEKVLATTSLEEFEKEYFEMAGFQDYQSYCQAINPIYVFENVKIPL
MILNAEDDPVCSIKNLEPYKEKIQQMSNIAVVTTKKGSHCGFYEGWKSTS
WAAKLISNYFMVNHKQ


References
    Title: Genome sequence of Acinetobacter calcoaceticus PHEA-2, isolated from industry wastewater
    Zhan Y, Yan Y, Zhang W, Yu H, Chen M, Lu W, Ping S, Peng Z, Yuan M and Lin M <2 more author(s)>
    Ref: Journal of Bacteriology, 193:2672, 2011 : PubMed

            

    Title: Complete genome sequence of the diesel-degrading Acinetobacter sp. strain DR1
    Jung J, Baek JH, Park W
    Ref: Journal of Bacteriology, 192:4794, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer