Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acica-elh1

Acinetobacter sp ., Acinetobacter baylyi, (beta-ketoadipate enol-lactone hydrolase 1) Carboxymethylbutenolide_lactonase like pcaD gene

Comment
Other strains: Acinetobacter sp ADP1, Acinetobacter baylyi DSM 14961 = CIP 107474


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Acinetobacter sp. ADP1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter sp. ADP1: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
3-Oxoadipate-enol-lactone
No inhibitor
3 Genbank : L05770, CR543861, APPT01000009
1 UniProt : Q59093
1 Ncbi-nid : 3264838
1 Ncbi-pid : 3172115
1 UniProt : Q59093
1 Interpro : Q59093
1 Prodom : Q59093
1 Pfam : Q59093
1 PIRSF : Q59093
1 SUPERFAM : Q59093
Sequence
Graphical view for this peptide sequence: acica-elh1
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MSEIHSIMITNRQGKTLSVQINGPENAPAIVFSNSLGTDHGMWQPQVAAL
KSQYRVVTYDTRGHGQSDVIENTTLQNLGEDVLDILDALNIEKAHFCGIS
MGGLTALWLGIYQAARFYSITVANSAAKIWTEDGWNARAEAVEANGLADL
VASTHTRWFSDKFDYKNDNLAQKTIQSLADTPAQGYANACRALAKADVRE
KLASISIPTLIIAGSADPVTTITDGEFMQQHIQCNQFEVIDASHLSNIEQ
PEKFIQIFSGFVKSIQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEIHSIMITNRQGKTLSVQINGPENAPAIVFSNSLGTDHGMWQPQVAAL
KSQYRVVTYDTRGHGQSDVIENTTLQNLGEDVLDILDALNIEKAHFCGIS
MGGLTALWLGIYQAARFYSITVANSAAKIWTEDGWNARAEAVEANGLADL
VASTHTRWFSDKFDYKNDNLAQKTIQSLADTPAQGYANACRALAKADVRE
KLASISIPTLIIAGSADPVTTITDGEFMQQHIQCNQFEVIDASHLSNIEQ
PEKFIQIFSGFVKSIQ


References
6 more
    Title: Identification of the transcriptional activator pobR and characterization of its role in the expression of pobA, the structural gene for p-hydroxybenzoate hydroxylase in Acinetobacter calcoaceticus
    DiMarco AA, Averhoff B, Ornston LN
    Ref: Journal of Bacteriology, 175:4499, 1993 : PubMed

            

    Title: Evolutionary divergence of pobA, the structural gene encoding p-hydroxybenzoate hydroxylase in an Acinetobacter calcoaceticus strain well-suited for genetic analysis
    DiMarco AA, Averhoff BA, Kim EE, Ornston LN
    Ref: Gene, 125:25, 1993 : PubMed

            

    Title: DNA sequences of genes encoding Acinetobacter calcoaceticus protocatechuate 3,4-dioxygenase: evidence indicating shuffling of genes and of DNA sequences within genes during their evolutionary divergence
    Hartnett C, Neidle EL, Ngai KL, Ornston LN
    Ref: Journal of Bacteriology, 172:956, 1990 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer