acica-este1

 
Acinetobacter calcoaceticus Acinetobacter lwoffii gene for esterase

Comment
Acinetobacter lwoffii


Relationship
Block H
Acinetobacter calcoaceticus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter calcoaceticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : M24890
1 UniProt : P18773
1 UniProtTrembl : P18773
1 Interpro : P18773
1 Prodom : P18773
1 Pfam : P18773
1 PIRSF : P18773
1 SUPERFAM : P18773
1 QuickSwissBlast : P18773
 
Sequence
Graphical view for this peptide sequence: acica-este1
Colored MSA for Hormone-sensitive_lipase_like (raw)
MKFGTVWKYYFTESLLKATIRTPSQLNLAPNALRPVLDQLCRLFPQNPTV
QIRPIRLAGVRGEEIKAQASATQLIFHIHGGAFFLGSLNTHRALMTDLAS
RTQMQVIHVDYPLAPEHPYPEAIDAIFDVYQALLVQGIKPKDIIISGDSC
GANLALALSLRLKQQPELMPSGLILMSPYLDLTLTSESLRFNQKHDALLS
IEALQAGIKHYLTDDIQPGDPRVSPLFDDLDGLPPTLVQVGSKEILLDDS
KRFREKAEQADVKVHFKLYTGMWNNFQMFNAWFPEAKQALADIAEFATSL
DLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFGTVWKYYFTESLLKATIRTPSQLNLAPNALRPVLDQLCRLFPQNPTV
QIRPIRLAGVRGEEIKAQASATQLIFHIHGGAFFLGSLNTHRALMTDLAS
RTQMQVIHVDYPLAPEHPYPEAIDAIFDVYQALLVQGIKPKDIIISGDSC
GANLALALSLRLKQQPELMPSGLILMSPYLDLTLTSESLRFNQKHDALLS
IEALQAGIKHYLTDDIQPGDPRVSPLFDDLDGLPPTLVQVGSKEILLDDS
KRFREKAEQADVKVHFKLYTGMWNNFQMFNAWFPEAKQALADIAEFATSL
DLD

Graphical view for this nucleotide DNA sequence (2232 bp): acica-este1



References
    Title: Growth-phase-dependent expression of the lipolytic system of Acinetobacter calcoaceticus BD413: cloning of a gene encoding one of the esterases
    Kok RG, Christoffels VM, Vosman B, Hellingwerf KJ
    Ref: J Gen Microbiol, 139:2329, 1993 : PubMed

            

    Title: Cloning and expression in Escherichia coli of an esterase-coding gene from the oil-degrading bacterium Acinetobacter calcoaceticus RAG-1
    Reddy PG, Allon R, Mevarech M, Mendelovitz S, Sato Y, Gutnick DL
    Ref: Gene, 76:145, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer