acica-este2

 
Acinetobacter calcoaceticus gene for esterase and (strain ADP1)

Relationship
Block H
Acinetobacter calcoaceticus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter calcoaceticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



3 Genbank : X71598, X74839, CR543861
1 UniProt : Q6F6N8
2 Ncbi-nid : 431227, 602780
1 Ncbi-pid : 1073180
2 UniProtTrembl : Q60123, Q6F6N8
2 Interpro : Q60123, Q6F6N8
2 Prodom : Q60123, Q6F6N8
2 Pfam : Q60123, Q6F6N8
2 PIRSF : Q60123, Q6F6N8
2 SUPERFAM : Q60123, Q6F6N8
2 QuickSwissBlast : Q60123, Q6F6N8
 
Sequence
Graphical view for this peptide sequence: acica-este2
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTAFVQTIQEVLEKGHGPAARALDKLPSFVQESIAKVLGYPYQYPQLDSF
IKCLMAVQIKQGQTGFIGSDVEKSRLAFETQMESILRKPTAITFVEDIRL
PLQSGTIFARHYHPAPNKKLPMIVFYHGGGFVVGNVDTHDEACRLIAKYA
NAQVLSIDYPLAPEVSPQRLIQSCEDALAWVYQNKRHFKILKNQIAVAGD
SAGGNISTVVAQRAIGKVYAQDAQFLIYPVVDFKSRHPSFYAYKDGLVLT
GNDVDYVTDYYATKHAVHLDDPIISPTYGNFKKLAPAYIVTAGHDVLHDE
GEIYSHKLRQAGVKIHFEEYLDQTHGFINLTPVSHKARANLIQMSKSFRK
FWNKYA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAFVQTIQEVLEKGHGPAARALDKLPSFVQESIAKVLGYPYQYPQLDSF
IKCLMAVQIKQGQTGFIGSDVEKSRLAFETQMESILRKPTAITFVEDIRL
PLQSGTIFARHYHPAPNKKLPMIVFYHGGGFVVGNVDTHDEACRLIAKYA
NAQVLSIDYPLAPEVSPQRLIQSCEDALAWVYQNKRHFKILKNQIAVAGD
SAGGNISTVVAQRAIGKVYAQDAQFLIYPVVDFKSRHPSFYAYKDGLVLT
GNDVDYVTDYYATKHAVHLDDPIISPTYGNFKKLAPAYIVTAGHDVLHDE
GEIYSHKLRQAGVKIHFEEYLDQTHGFINLTPVSHKARANLIQMSKSFRK
FWNKYA

Graphical view for this nucleotide DNA sequence (1879 bp): acica-este2



References
    Title: Unique features revealed by the genome sequence of Acinetobacter sp. ADP1, a versatile and naturally transformation competent bacterium
    Barbe V, Vallenet D, Fonknechten N, Kreimeyer A, Oztas S, Labarre L, Cruveiller S, Robert C, Duprat S and Medigue C <5 more author(s)>
    Ref: Nucleic Acids Research, 32:5766, 2004 : PubMed

            

    Title: A gene of Acinetobacter calcoaceticus BD413 encodes a periplasmic peptidyl-prolyl cis-trans isomerase of the cyclophilin sub-class that is not essential for growth
    Kok RG, Christoffels VM, Vosman B, Hellingwerf KJ
    Ref: Biochimica & Biophysica Acta, 1219:601, 1994 : PubMed

            

    Title: Growth-phase-dependent expression of the lipolytic system of Acinetobacter calcoaceticus BD413: cloning of a gene encoding one of the esterases
    Kok RG, Christoffels VM, Vosman B, Hellingwerf KJ
    Ref: J Gen Microbiol, 139:2329, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer