Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acica-este3

Acinetobacter calcoaceticus extracellular lipase, LipA Acinetobacter sp. (strain ADP1)

Relationship
Family|Bacterial_lip_FamI.1
Block| L
Position in NCBI Life Tree|Acinetobacter calcoaceticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter calcoaceticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : X80800, CR543861
2 UniProt : Q43962, Q6F7I3
1 Ncbi-nid : 870829
2 UniProt : Q6F7I3, Q43962
2 Interpro : Q6F7I3, Q43962
2 Prodom : Q6F7I3, Q43962
2 Pfam : Q6F7I3, Q43962
2 PIRSF : Q6F7I3, Q43962
2 SUPERFAM : Q6F7I3, Q43962
Sequence
Graphical view for this peptide sequence: acica-este3
Colored MSA for Bacterial_lip_FamI.1 (raw)
MKFKLLFTTLLLVLTQPVFATSPIQNPTTSFVISDYAKTKYPIVLSHGLF
GFNKLGTEAFGLDYWYQIPQDLARNGANVWVTRQSTANTSEFRGEQLLAE
VQDILAITGAQKVNLIGHSHGSQTVRYVAGVLPANIASVSTIGGPAKGAP
LADLIYKTLAGTPLEAPIATIFNVAMNFITIGQFDDPQKYPMNSVGAAYS
LSTEGAGKFNAIFPAGVPTTACGQGESSVNGVRYYSWSGASPLTNPLDPS
DYGLSLTSVFSGKNNDGLVPSCSSHLGTVIRDNYVWNHLDEVNQILGFDL
FLHKTPYPSLDNMPIVSKVKIYN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFKLLFTTLLLVLTQPVFATSPIQNPTTSFVISDYAKTKYPIVLSHGLF
GFNKLGTEAFGLDYWYQIPQDLARNGANVWVTRQSTANTSEFRGEQLLAE
VQDILAITGAQKVNLIGHSHGSQTVRYVAGVLPANIASVSTIGGPAKGAP
LADLIYKTLAGTPLEAPIATIFNVAMNFITIGQFDDPQKYPMNSVGAAYS
LSTEGAGKFNAIFPAGVPTTACGQGESSVNGVRYYSWSGASPLTNPLDPS
DYGLSLTSVFSGKNNDGLVPSCSSHLGTVIRDNYVWNHLDEVNQILGFDL
FLHKTPYPSLDNMPIVSKVKIYN


References
    Title: Unique features revealed by the genome sequence of Acinetobacter sp. ADP1, a versatile and naturally transformation competent bacterium
    Barbe V, Vallenet D, Fonknechten N, Kreimeyer A, Oztas S, Labarre L, Cruveiller S, Robert C, Duprat S and Medigue C <5 more author(s)>
    Ref: Nucleic Acids Research, 32:5766, 2004 : PubMed

            

    Title: Characterization of the extracellular lipase, LipA, of Acinetobacter calcoaceticus BD413 and sequence analysis of the cloned structural gene
    Kok RG, van Thor JJ, Nugteren-Roodzant IM, Brouwer MB, Egmond MR, Nudel CB, Vosman B, Hellingwerf KJ
    Ref: Molecular Microbiology, 15:803, 1995 : PubMed

            

    Title: Characterization of lipase-deficient mutants of Acinetobacter calcoaceticus BD413: identification of a periplasmic lipase chaperone essential for the production of extracellular lipase
    Kok RG, van Thor JJ, Nugteren-Roodzant IM, Vosman B, Hellingwerf KJ
    Ref: Journal of Bacteriology, 177:3295, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer