Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acice-q2e207

Acidothermus cellulolyticus 11B dipeptidyl aminopeptidases/acylaminoacyl-peptidases-like

Comment
Other strains: Acidothermus cellulolyticus (strain ATCC 43068 / 11B)


Relationship
Family|Duf_1100-S
Block| X
Position in NCBI Life Tree|Acidothermus cellulolyticus 11B
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Acidothermales: N E > Acidothermaceae: N E > Acidothermus: N E > Acidothermus cellulolyticus: N E > Acidothermus cellulolyticus 11B: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAOL01000001, WP_011719726, ABK52663
1 UniProt : A0LTA3
1 Interpro : A0LTA3
1 Pfam : A0LTA3
1 PIRSF : A0LTA3
1 SUPERFAM : A0LTA3
Sequence
Graphical view for this peptide sequence: acice-q2e207
Colored MSA for Duf_1100-S (raw)
MVDERVRIAIENWGPRFTTNGVTYSDFHEVLSRITTWEEWCSAWCTAAEP
YVELGRAALDEGRTLSAGDHFSQAAVYYHFAKFLFVDDMEQMRAAHQKAV
ECLTTALPYLDPPGRRITVPFEGARMVGILRLPRGEPPFPAVMLIPGLDS
TKEEFRSTEQLFLQRGLATFSVDGPGQGEAEYDLPIRPDWEVPGAALLDA
LASQPEIDPARLGIWGVSLGGYYAPRLASGDQRVKACIALAGPWNFGACW
DGLNELTRAAFRVRSRSRSDEEARAKAAQLTLDGRAERIRCPLLVVAGKR
DRLIPWQDAVRLAEAAGSQAELLLLENGNHGGMNVAAQHRQRSADWMARI
LGGRVAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVDERVRIAIENWGPRFTTNGVTYSDFHEVLSRITTWEEWCSAWCTAAEP
YVELGRAALDEGRTLSAGDHFSQAAVYYHFAKFLFVDDMEQMRAAHQKAV
ECLTTALPYLDPPGRRITVPFEGARMVGILRLPRGEPPFPAVMLIPGLDS
TKEEFRSTEQLFLQRGLATFSVDGPGQGEAEYDLPIRPDWEVPGAALLDA
LASQPEIDPARLGIWGVSLGGYYAPRLASGDQRVKACIALAGPWNFGACW
DGLNELTRAAFRVRSRSRSDEEARAKAAQLTLDGRAERIRCPLLVVAGKR
DRLIPWQDAVRLAEAAGSQAELLLLENGNHGGMNVAAQHRQRSADWMARI
LGGRVAG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer