Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acicp-f0kfi4

Acinetobacter calcoaceticus (strain PHEA-2) Lipase

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Acinetobacter calcoaceticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter calcoaceticus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_014205960, YP_004994386
1 UniProt : F0KFI4
1 Interpro : F0KFI4
1 Prodom : F0KFI4
1 Pfam : F0KFI4
1 PIRSF : F0KFI4
1 SUPERFAM : F0KFI4
Sequence
Graphical view for this peptide sequence: acicp-f0kfi4
Colored MSA for Hormone-sensitive_lipase_like (raw)
MTTCEQTTYALSEEMQSLVYWSSIYSPADADIDSVRAAYDAMCRHYTLPR
DGKIEVEDRVVANAEHSVPVRIYSPKTKRPEAGWPCVLYLHGGGWMVGGL
YSHEFITSYLCQDLNAVVIGVDYRMAPEHRFPAAFEDCLAVYQWLKQHGS
DWQIDSENIVLAGDSVGGNLAAALAVHLQHSGLQAQGLALVYPCLTIALD
TPAAQKHAHAPLLTTEDMHFYLKEYAPNSQDWQDLRLAPLLATDFSDMPT
SFVTVAEYDPLSDDGYFFTQKLEQAGIPNEFHLGKGLLHGSLRLMRDCPE
VQQLYQNMLSAIRRMFGSVEKISI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTCEQTTYALSEEMQSLVYWSSIYSPADADIDSVRAAYDAMCRHYTLPR
DGKIEVEDRVVANAEHSVPVRIYSPKTKRPEAGWPCVLYLHGGGWMVGGL
YSHEFITSYLCQDLNAVVIGVDYRMAPEHRFPAAFEDCLAVYQWLKQHGS
DWQIDSENIVLAGDSVGGNLAAALAVHLQHSGLQAQGLALVYPCLTIALD
TPAAQKHAHAPLLTTEDMHFYLKEYAPNSQDWQDLRLAPLLATDFSDMPT
SFVTVAEYDPLSDDGYFFTQKLEQAGIPNEFHLGKGLLHGSLRLMRDCPE
VQQLYQNMLSAIRRMFGSVEKISI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer