Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acicp-f0khy0

Acinetobacter calcoaceticus (strain PHEA-2) Acinetobacter sp. SH024 Lipase

Relationship
Family|Fungal-Bact_LIP
Block| X
Position in NCBI Life Tree|Acinetobacter calcoaceticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter calcoaceticus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP002177, GG753603
1 UniProt : F0KHY0
1 UniProt : F0KHY0
1 Interpro : F0KHY0
1 Prodom : F0KHY0
1 Pfam : F0KHY0
1 PIRSF : F0KHY0
1 SUPERFAM : F0KHY0
Sequence
Graphical view for this peptide sequence: acicp-f0khy0
Colored MSA for Fungal-Bact_LIP (raw)
MSGSAMAAQITDLGNQIVNEKPGSILSLEQQAVTDLFPHADQRLLVNYRS
RGIQDEPIVASAFILLPKGTPPKNGWPILAWAHGTTGVADTCAPSGDYVG
GPVHSYQEVASKALDGWLARGYAVVAPDYQGLGTLGAHPYMNAKSQLHTV
VDAVRALHMLKPKSFNKQWLVMGHSQGGAAAIAVSAYGQKDAPELDLKGA
IALAPGGYQYEGIAEYVQSNPNPEPSVAAFFPIVLLGAQAAEPSIVPENL
VSPEMNTVLTQARSRCLSELQSDLKKSPSSIFRPNADLKPLLTYLKQQSI
ENMVPTVPLMIVQGSKDHLVDPRGTSAYYQQLCKLKKPTIYQTIDGGDHR
DALRQSNTFATHFLNVIEKNQTKSYCSNSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSGSAMAAQITDLGNQIVNEKPGSILSLEQQAVTDLFPHADQRLLVNYRS
RGIQDEPIVASAFILLPKGTPPKNGWPILAWAHGTTGVADTCAPSGDYVG
GPVHSYQEVASKALDGWLARGYAVVAPDYQGLGTLGAHPYMNAKSQLHTV
VDAVRALHMLKPKSFNKQWLVMGHSQGGAAAIAVSAYGQKDAPELDLKGA
IALAPGGYQYEGIAEYVQSNPNPEPSVAAFFPIVLLGAQAAEPSIVPENL
VSPEMNTVLTQARSRCLSELQSDLKKSPSSIFRPNADLKPLLTYLKQQSI
ENMVPTVPLMIVQGSKDHLVDPRGTSAYYQQLCKLKKPTIYQTIDGGDHR
DALRQSNTFATHFLNVIEKNQTKSYCSNSK


Reference
    Title: Genome sequence of Acinetobacter calcoaceticus PHEA-2, isolated from industry wastewater
    Zhan Y, Yan Y, Zhang W, Yu H, Chen M, Lu W, Ping S, Peng Z, Yuan M and Lin M <2 more author(s)>
    Ref: Journal of Bacteriology, 193:2672, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer