Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acigi-a0a077l147

Acinetobacter guillouiae (Acinetobacter genomosp. 11). Putative carboxylesterase

Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Acinetobacter guillouiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter guillouiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP014630
1 UniProt : A0A077L147
1 UniProt : A0A077L147
1 Interpro : A0A077L147
1 Prodom : A0A077L147
1 Pfam : A0A077L147
1 PIRSF : A0A077L147
1 SUPERFAM : A0A077L147
Sequence
Graphical view for this peptide sequence: acigi-a0a077l147
Colored MSA for CarbLipBact_1 (raw)
MLKLRQPKPLFLKASQQAVLLLHAYTSTIQDMKALAKFLHQHGYTCYAPS
YAGHGLTIDEFLDYTTADWWQDTYNAYQLLENQGYKHIAVIGVSLGAILS
LKLTEHFPIDACISMSAPQDRSVNDLFKRLEHYAEYLHQFQNSNVELDLK
SLENKAAIQLQAFHEFVAATISNVSLIRAPIFLLYGELDDAHYQSSAQTI
YNYVKSTEKKIKSYPNTGHLMTLGKDQTQLFSDILDFLDQHHPIQP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLKLRQPKPLFLKASQQAVLLLHAYTSTIQDMKALAKFLHQHGYTCYAPS
YAGHGLTIDEFLDYTTADWWQDTYNAYQLLENQGYKHIAVIGVSLGAILS
LKLTEHFPIDACISMSAPQDRSVNDLFKRLEHYAEYLHQFQNSNVELDLK
SLENKAAIQLQAFHEFVAATISNVSLIRAPIFLLYGELDDAHYQSSAQTI
YNYVKSTEKKIKSYPNTGHLMTLGKDQTQLFSDILDFLDQHHPIQP


Reference
    Title: Complete Genome Sequence of a Dimethyl Sulfide-Utilizing Bacterium, Acinetobacter guillouiae Strain 20B (NBRC 110550)
    Yee L, Hosoyama A, Ohji S, Tsuchikane K, Shimodaira J, Yamazoe A, Fujita N, Suzuki-Minakuchi C, Nojiri H
    Ref: Genome Announc, 2:, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer