Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acigi-n8ybk0

Acinetobacter guillouiae, Acinetobacter sp. 3-oxoadipate enol-lactonase

Comment
Other strains: Acinetobacter guillouiae (NIPH 991; CIP 63.46; MSP4-18) (Acinetobacter genomosp. 11)., Acinetobacter sp. ETR1


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Acinetobacter guillouiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter guillouiae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: acigi-n8ybk0
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MPTFQSADAQINYQSFGNPNSPALVFSNSLGTNYGMWQKQFNYFKERFFV
ICYDTRGHGSSSAPQGPYTLPQLAEDVIRLLDHLNIEKASFCGISMGGLT
GQWLAIHYPQRFNAVVISNTAAKIGQEQAWLDRAQLVREQGLTSIAATAA
SRWFTDPFIQSHPAIVNNLCNDLSAGSAIGYANCCEALAKADVRNQLKDI
TIPVLVIAGTQDPVTTVADGQFMQQHIPQSQLVEIQASHISNIECPEAFN
AALEKFLSAIFATEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPTFQSADAQINYQSFGNPNSPALVFSNSLGTNYGMWQKQFNYFKERFFV
ICYDTRGHGSSSAPQGPYTLPQLAEDVIRLLDHLNIEKASFCGISMGGLT
GQWLAIHYPQRFNAVVISNTAAKIGQEQAWLDRAQLVREQGLTSIAATAA
SRWFTDPFIQSHPAIVNNLCNDLSAGSAIGYANCCEALAKADVRNQLKDI
TIPVLVIAGTQDPVTTVADGQFMQQHIPQSQLVEIQASHISNIECPEAFN
AALEKFLSAIFATEL


Reference
    Title: Complete Genome Sequence of a Dimethyl Sulfide-Utilizing Bacterium, Acinetobacter guillouiae Strain 20B (NBRC 110550)
    Yee L, Hosoyama A, Ohji S, Tsuchikane K, Shimodaira J, Yamazoe A, Fujita N, Suzuki-Minakuchi C, Nojiri H
    Ref: Genome Announc, 2:, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer