Gene_locus Report for: acijo-d0sfj7Acinetobacter johnsonii. Uncharacterized protein Comment Other strains: Acinetobacter johnsonii (SH046; CIP 64.6; ANC 3681) Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter johnsonii: N E > Acinetobacter johnsonii SH046: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Acinetobacter johnsonii CIP 64.6: N, E.
Acinetobacter johnsonii ANC 3681: N, E.
Molecular evidence | | Database | No mutation
No structure
No kinetic
No Substrate
No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: acijo-d0sfj7
Colored MSA for abh_upf00227 (raw)
MYSMNIIYLHGFQSSSLSIKGQLLKRYCESRPQWHVHLPDLNMPPHLALE
KLAALIQELDQVVLVGSSLGGFYATQLVAKLAVPAVLINPAMQPWHLFRN
LFGATQLPYRVNEHWTLDDAQLDYLEQIELPFVQDADKILVLLQQGDEVL
DYREAQRYYNGAALVISETQGNHAMEDFADKIPMALQFLSDCLK
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MYSMNIIYLHGFQSSSLSIKGQLLKRYCESRPQWHVHLPDLNMPPHLALE
KLAALIQELDQVVLVGSSLGGFYATQLVAKLAVPAVLINPAMQPWHLFRN
LFGATQLPYRVNEHWTLDDAQLDYLEQIELPFVQDADKILVLLQQGDEVL
DYREAQRYYNGAALVISETQGNHAMEDFADKIPMALQFLSDCLK
|
|
|
|
