Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciju-d0sik6

Acinetobacter junii 3-oxoadipate enol-lactonase

Comment
Other strains: Acinetobacter junii (SH205; MTCC 11364; CIP 107470; NIPH 182; CIP 64.5)


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Acinetobacter junii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter junii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: GG705011, ASYZ01000115, APPS01000047
2 UniProt : D0SIK6, S7Y7Y4
2 UniProt : D0SIK6, S7Y7Y4
2 Interpro : D0SIK6, S7Y7Y4
2 Pfam : D0SIK6, S7Y7Y4
2 PIRSF : D0SIK6, S7Y7Y4
2 SUPERFAM : D0SIK6, S7Y7Y4
Sequence
Graphical view for this peptide sequence: aciju-d0sik6
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MPMFQSADVMIHYQTFGDANAPALVFSNSLGTNFGMWQQQFNFFKDRFFV
ICYDTRGHGSSSTPTGPYTLQQLGEDVIALLDHLKIEKAAFCGISMGGLT
GQSLAIHYPSRFSHVIIANTAAKIGQEQAWQDRAELVRKQGLEPIAATAA
SRWFTDPFIQSHPSVVSHLCNDLSAGSALGYANCCEALAKADLRDELKQI
TIPVLIIAGIHDPVTTVTDAEWMLQHIPKAQLVEINASHISNVEAPVEFN
QYINQFI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPMFQSADVMIHYQTFGDANAPALVFSNSLGTNFGMWQQQFNFFKDRFFV
ICYDTRGHGSSSTPTGPYTLQQLGEDVIALLDHLKIEKAAFCGISMGGLT
GQSLAIHYPSRFSHVIIANTAAKIGQEQAWQDRAELVRKQGLEPIAATAA
SRWFTDPFIQSHPSVVSHLCNDLSAGSALGYANCCEALAKADLRDELKQI
TIPVLIIAGIHDPVTTVTDAEWMLQHIPKAQLVEINASHISNVEAPVEFN
QYINQFI



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer