acilw-rag1e

 
Acinetobacter lwoffii oil-degrading RAG-1 Esterase

Relationship
Block H
Acinetobacter lwoffii position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter lwoffii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic



2 Genbank : 738110, L38252
1 Ncbi-nid : 738110
1 UniProtTrembl : Q44087
1 Interpro : Q44087
1 Prodom : Q44087
1 Pfam : Q44087
1 PIRSF : Q44087
1 SUPERFAM : Q44087
1 QuickSwissBlast : Q44087
 
Sequence
Graphical view for this peptide sequence: acilw-rag1e
Colored MSA for Hormone-sensitive_lipase_like (raw)
MKFGTVWKYYFTESLLKATIRTPSQLNLAPNALRPVLDQLCRLFPQNPTV
QIRPIRLAGVRGEEIKAQASATQLIFHIHGGAFFLGSLNTHRALMTDLAA
RTQMQVIHVDYPLAPEHPYPEAIDAIFDVYQALLVQGIKPKDIIISGDSC
GANLALALCLRLKQQPELMPSGLILMSPYLDLTLTSESLRFNQKHDALLS
IEALQAGIKHYLTDDIQPGDPRVSPLFDDLDGLPPTLVQVGSKEILLDDS
KRFREKAEQADVKVHFKLYTGMWHNFQMFNAWFPEAKQALADIAEFAHSL
DLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFGTVWKYYFTESLLKATIRTPSQLNLAPNALRPVLDQLCRLFPQNPTV
QIRPIRLAGVRGEEIKAQASATQLIFHIHGGAFFLGSLNTHRALMTDLAA
RTQMQVIHVDYPLAPEHPYPEAIDAIFDVYQALLVQGIKPKDIIISGDSC
GANLALALCLRLKQQPELMPSGLILMSPYLDLTLTSESLRFNQKHDALLS
IEALQAGIKHYLTDDIQPGDPRVSPLFDDLDGLPPTLVQVGSKEILLDDS
KRFREKAEQADVKVHFKLYTGMWHNFQMFNAWFPEAKQALADIAEFAHSL
DLD

no DNA




References
    Title: Esterase from the oil-degrading Acinetobacter lwoffii RAG-1. Sequence analysis and over-expression in Escherichia coli
    Alon RN, Gutnick DL
    Ref: FEMS Microbiology Letters, 112 (3):275, 1993 : PubMed

            

    Title: Cloning and expression in Escherichia coli of an esterase-coding gene from the oil-degrading bacterium Acinetobacter calcoaceticus RAG-1
    Reddy PG, Allon R, Mevarech M, Mendelovitz S, Sato Y, Gutnick DL
    Ref: Gene, 76:145, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer