Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: actti-q6zzg3

Actinoplanes teichomyceticus thioesterase, type II

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Actinoplanes teichomyceticus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micromonosporales: N E > Micromonosporaceae: N E > Actinoplanes: N E > Actinoplanes teichomyceticus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AJ632270, AJ605139
1 UniProt : Q6ZZG3
1 UniProt : Q6ZZG3
1 Interpro : Q6ZZG3
1 Prodom : Q6ZZG3
1 Pfam : Q6ZZG3
1 PIRSF : Q6ZZG3
1 SUPERFAM : Q6ZZG3
Sequence
Graphical view for this peptide sequence: actti-q6zzg3
Colored MSA for Thioesterase (raw)
MPVPWFSAPRPLAAPRLRLVCFPYAGGNAATYRSWAGLLPPGVELVAALL
PGRAERLDEPPLVDLDVLLSELVAAAGPLLGPVPLILFGHSLGATVAYEF
GRALATEHGCVPAALLVSGAPAPPVRRRRTGRGLSDDDLERILGKRTDLP
AGWLTAELKPFVFPALRADLQLLDGYRWRPGPLPGVPVVAFGGDADPDVS
AADLRAWQRCTTGPARTHVLAGDHFFIAHQPFRELLAATVGEFAASPIAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPVPWFSAPRPLAAPRLRLVCFPYAGGNAATYRSWAGLLPPGVELVAALL
PGRAERLDEPPLVDLDVLLSELVAAAGPLLGPVPLILFGHSLGATVAYEF
GRALATEHGCVPAALLVSGAPAPPVRRRRTGRGLSDDDLERILGKRTDLP
AGWLTAELKPFVFPALRADLQLLDGYRWRPGPLPGVPVVAFGGDADPDVS
AADLRAWQRCTTGPARTHVLAGDHFFIAHQPFRELLAATVGEFAASPIAR


References
    Title: Biosynthetic gene cluster of the glycopeptide antibiotic teicoplanin: characterization of two glycosyltransferases and the key acyltransferase
    Li TL, Huang F, Haydock SF, Mironenko T, Leadlay PF, Spencer JB
    Ref: Chemical Biology, 11:107, 2004 : PubMed

            

    Title: Organization of the teicoplanin gene cluster in Actinoplanes teichomyceticus
    Sosio M, Kloosterman H, Bianchi A, de Vreugd P, Dijkhuizen L, Donadio S
    Ref: Microbiology, 150:95, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer