Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aedae-q0iea6

Aedes aegypti (Yellowfever mosquito) (Culex aegypti) AAEL012590-PA

Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Aedes aegypti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Culicinae: N E > Aedini: N E > Aedes: N E > Stegomyia: N E > Aedes aegypti: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CH477899, CH477908
2 UniProt : Q0IEA6, Q16LF1
2 UniProt : Q0IEA6, Q16LF1
2 Interpro : Q0IEA6, Q16LF1
2 Prodom : Q0IEA6, Q16LF1
2 Pfam : Q0IEA6, Q16LF1
2 PIRSF : Q0IEA6, Q16LF1
2 SUPERFAM : Q0IEA6, Q16LF1
Sequence
Graphical view for this peptide sequence: aedae-q0iea6
Colored MSA for Prolylcarboxypeptidase (raw)
MIVKAFAFLGIAVALASAAITINPSRPVLFGTHRVIPRNLGSNAESNNTA
LWNTVNLRQVYTNPQNRNSFSMRYVTNNRHYRRGGPIFLFVGGPWPLEAH
LVEQGHFVDMAAEMNGFLVANELRYYGESIPVEDVSRNNFRYLHNVQILS
ELATFIAHLKEDVVRDPNAKVILAGVGYSASLAQWMRQRFPHLIHGVWSS
SGMVRASTNYREFAEVVGENIRRFGGDDCYSTIWRAFRTAENLIDAGLST
TVDELFHTCRPIDAANALEVEAFFYGIFNEISREVVDADLRGNIKQMCEP
LTASDDENSLLELASWLTGRFPNAECLAMDFQSIVDTYNTIDVDSEIVKS
GERQWMFQRCTELGWPLTAASQYQPFGRRFSTDLFHGICEQLFDDWLTRD
RFEALIRQTNDYYGGARPDIRNSISTQGTLDPWSFAGVREVIFNNTYVTI
IRDAFHGQDMASISEEDSIELRRSKEMVRDTIRRWVETR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIVKAFAFLGIAVALASAAITINPSRPVLFGTHRVIPRNLGSNAESNNTA
LWNTVNLRQVYTNPQNRNSFSMRYVTNNRHYRRGGPIFLFVGGPWPLEAH
LVEQGHFVDMAAEMNGFLVANELRYYGESIPVEDVSRNNFRYLHNVQILS
ELATFIAHLKEDVVRDPNAKVILAGVGYSASLAQWMRQRFPHLIHGVWSS
SGMVRASTNYREFAEVVGENIRRFGGDDCYSTIWRAFRTAENLIDAGLST
TVDELFHTCRPIDAANALEVEAFFYGIFNEISREVVDADLRGNIKQMCEP
LTASDDENSLLELASWLTGRFPNAECLAMDFQSIVDTYNTIDVDSEIVKS
GERQWMFQRCTELGWPLTAASQYQPFGRRFSTDLFHGICEQLFDDWLTRD
RFEALIRQTNDYYGGARPDIRNSISTQGTLDPWSFAGVREVIFNNTYVTI
IRDAFHGQDMASISEEDSIELRRSKEMVRDTIRRWVETR


Reference
    Title: Genome sequence of Aedes aegypti, a major arbovirus vector
    Nene V, Wortman JR, Lawson D, Haas B, Kodira C, Tu ZJ, Loftus B, Xi Z, Megy K and Severson DW <85 more author(s)>
    Ref: Science, 316:1718, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer