Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aedae-q177c7

Aedes aegypti (Yellowfever mosquito) (Culex aegypti) Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta) AAEL006171-PA

Comment
Other strains: Aedes aegypti (Yellowfever mosquito) (Culex aegypti); Aedes albopictus (Asian tiger mosquito) (Stegomyia albopicta)


Relationship
Family|Ndr_family
Block| X
Position in NCBI Life Tree|Aedes aegypti
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Culicinae: N E > Aedini: N E > Aedes: N E > Stegomyia: N E > Aedes aegypti: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aedae-q177c7
Colored MSA for Ndr_family (raw)
RYAVKTEKSGELIVTVQGDLSQQEKRAVFLTVHDLGCNHTSFEDFVNSAC
MIEIKERSCFIHIDVPGHADNAPTLPDNFQFPTLQTLGEELITVLDFLHV
KYVIGLGEGAGANVLARFGLAHPSRCLGLILINVTGSAASVLDAFKTKFI
SWKGDEIGQSAEDFLLYHKFGYQLVGDNPDKEKIVTEFQSRLHSSLNNKN
LKQYVKAFTSRENLCLKNCKVDLLLVTGVMSPYAGVVEKMFKDLNKEKVT
LLKVERAGDVLADAPAKVAQSILLFCKGQGLLTSVVLPGVDRNRAFSTSS
GGSSDGTPGGRRLSRGMSMEDYDKPNIRRLSITINEQLPPIKK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RYAVKTEKSGELIVTVQGDLSQQEKRAVFLTVHDLGCNHTSFEDFVNSAC
MIEIKERSCFIHIDVPGHADNAPTLPDNFQFPTLQTLGEELITVLDFLHV
KYVIGLGEGAGANVLARFGLAHPSRCLGLILINVTGSAASVLDAFKTKFI
SWKGDEIGQSAEDFLLYHKFGYQLVGDNPDKEKIVTEFQSRLHSSLNNKN
LKQYVKAFTSRENLCLKNCKVDLLLVTGVMSPYAGVVEKMFKDLNKEKVT
LLKVERAGDVLADAPAKVAQSILLFCKGQGLLTSVVLPGVDRNRAFSTSS
GGSSDGTPGGRRLSRGMSMEDYDKPNIRRLSITINEQLPPIKK


References
    Title: Genome sequence of the Asian Tiger mosquito, Aedes albopictus, reveals insights into its biology, genetics, and evolution
    Chen XG, Jiang X, Gu J, Xu M, Wu Y, Deng Y, Zhang C, Bonizzoni M, Dermauw W and James AA <21 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 112:E5907, 2015 : PubMed

            

    Title: Identification and characterization of seminal fluid proteins in the Asian tiger mosquito, Aedes albopictus
    Boes KE, Ribeiro JM, Wong A, Harrington LC, Wolfner MF, Sirot LK
    Ref: PLoS Negl Trop Dis, 8:e2946, 2014 : PubMed

            

    Title: Genome sequence of Aedes aegypti, a major arbovirus vector
    Nene V, Wortman JR, Lawson D, Haas B, Kodira C, Tu ZJ, Loftus B, Xi Z, Megy K and Severson DW <85 more author(s)>
    Ref: Science, 316:1718, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer