Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aerpe-APE2361

Aeropyrum pernix hypothetical 26.0 kda protein ape2361

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Aeropyrum pernix
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Desulfurococcales: N E > Desulfurococcaceae: N E > Aeropyrum: N E > Aeropyrum pernix: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP000064
1 UniProt : Q9Y9C6
1 Interpro : Q9Y9C6
1 Prodom : Q9Y9C6
1 Pfam : Q9Y9C6
1 PIRSF : Q9Y9C6
1 SUPERFAM : Q9Y9C6
Sequence
Graphical view for this peptide sequence: aerpe-APE2361
Colored MSA for Epoxide_hydrolase (raw)
MLHGLGENSRVWLHIARLAAGLGARIVLPDLRGHGGSRPGQGGVSLEAMA
KDLEALVKREGQGRVHLMGFSLGGFVVLEAVDKDILEPGGGFESAILVGA
LHRPADPEGMRARARLARERGVEEAARAIAAAVYRGVNMNLAYQAALKLL
QRIGPHVYASIVEELAGRDYTRAFQRLTAEAPTTVVVGSRDPLAAGLLEE
ARRILGPRGRIVVIEGAGHLVHLEAASRLIEAVKTHLGSALGGQGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLHGLGENSRVWLHIARLAAGLGARIVLPDLRGHGGSRPGQGGVSLEAMA
KDLEALVKREGQGRVHLMGFSLGGFVVLEAVDKDILEPGGGFESAILVGA
LHRPADPEGMRARARLARERGVEEAARAIAAAVYRGVNMNLAYQAALKLL
QRIGPHVYASIVEELAGRDYTRAFQRLTAEAPTTVVVGSRDPLAAGLLEE
ARRILGPRGRIVVIEGAGHLVHLEAASRLIEAVKTHLGSALGGQGL


Reference
    Title: Complete genome sequence of an aerobic hyper-thermophilic crenarchaeon, Aeropyrum pernix K1
    Kawarabayasi Y, Hino Y, Horikawa H, Yamazaki S, Haikawa Y, Jin-no K, Takahashi M, Sekine M, Baba S and Kikuchi H <20 more author(s)>
    Ref: DNA Research, 6:83, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer