Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aerpu-PEP

Aeromonas punctata subsp. punctata prolyl endopeptidase (EC 3.4.21.26)

Comment
the sequence is from the structure: Li et al. Other strains: Aeromonas punctata (Aeromonas caviae), Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240), Aeromonas salmonicida (strain A449)


Relationship
Family|S9N_PPCE_Peptidase_S9
Block| X
Position in NCBI Life Tree|Aeromonas punctata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Aeromonadales: N E > Aeromonadaceae: N E > Aeromonas: N E > Aeromonas caviae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
9 structures (e.g. : 3IUJ, 3IUL, 3IUM... more)
No kinetic





No Substrate
1 inhbitor:
Z-Pro-Prolinal
2 Genbank : AF065429, AF143951
>3 UniProt links 1 more: Q9RBG8, Q9X6R4, A4SRN3
>3 Structure links 6 more: 3MUN, 3MUO, 3IUJ
>3 UniProt links 1 more: Q9RBG8, Q9X6R4, A4SRN3
>3 Interpro links 1 more: Q9RBG8, Q9X6R4, A4SRN3
>3 Prodom links 1 more: Q9RBG8, Q9X6R4, A4SRN3
>3 Pfam links 1 more: Q9RBG8, Q9X6R4, A4SRN3
>3 PIRSF links 1 more: Q9RBG8, Q9X6R4, A4SRN3
>3 SUPERFAM links 1 more: Q9RBG8, Q9X6R4, A4SRN3
Sequence
Graphical view for this peptide sequence: aerpu-PEP
Colored MSA for S9N_PPCE_Peptidase_S9 (raw)
GSHMSGKARLHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKA
QNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQ
NQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLA
GSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSE
LSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLI
SAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNR
DAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATA
RVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYR
FEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKL
DGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQA
WHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAV
MTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLK
GYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQ
LIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GSHMSGKARLHYPVTRQGEQVDHYFGQAVADPYRWLEDDRSPETEAWVKA
QNAVTQDYLAQIPYRAAIKEKLAASWNYAKEGAPFREGRYHYFFKNDGLQ
NQNVLWRQQEGKPAEVFLDPNTLSPDGTTALDQLSFSRDGRILAYSLSLA
GSDWREIHLMDVESKQPLETPLKDVKFSGISWLGNEGFFYSSYDKPDGSE
LSARTDQHKVYFHRLGTAQEDDRLVFGAIPAQHHRYVGATVTEDDRFLLI
SAANSTSGNRLYVKDLSQENAPLLTVQGDLDADVSLVDNKGSTLYLLTNR
DAPNRRLVTVDAANPGPAHWRDLIPERQQVLTVHSGSGYLFAEYMVDATA
RVEQFDYEGKRVREVALPGLGSVSGFNGKHDDPALYFGFENYAQPPTLYR
FEPKSGAISLYRASAAPFKPEDYVSEQRFYQSKDGTRVPLIISYRKGLKL
DGSNPTILYGYGGFDVSLTPSFSVSVANWLDLGGVYAVANLRGGGEYGQA
WHLAGTQQNKQNVFDDFIAAAEYLKAEGYTRTDRLAIRGGSNGGLLVGAV
MTQRPDLMRVALPAVGVLDMLRYHTFTAGTGWAYDYGTSADSEAMFDYLK
GYSPLHNVRPGVSYPSTMVTTADHDDRVVPAHSFKFAATLQADNAGPHPQ
LIRIETNAGHGAGTPVAKLIEQSADIYAFTLYEMGYRELPRQP


References
1 more
    Title: Induced-fit mechanism for prolyl endopeptidase
    Li M, Chen C, Davies DR, Chiu TK
    Ref: Journal of Biological Chemistry, 285:21487, 2010 : PubMed

            

    Title: The genome of Aeromonas salmonicida subsp. salmonicida A449: insights into the evolution of a fish pathogen
    Reith ME, Singh RK, Curtis B, Boyd JM, Bouevitch A, Kimball J, Munholland J, Murphy C, Sarty D and Brown LL <3 more author(s)>
    Ref: BMC Genomics, 9:427, 2008 : PubMed

            

    Title: Cloning and Nucleotide Sequencing of Prolyl Endopeptidase Gene from Aeromonas punctata subsp. punctata
    Shen GX, Shi JP
    Ref: Sheng Wu Hua Xue Yu Sheng Wu Wu Li Xue Bao (Shanghai), 31:567, 1999 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer