Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: agrt5-q7d3t6

Agrobacterium tumefaciens (strain C58 / ATCC 33970) agr_pat_205p

Relationship
Family|Prolyl_oligopeptidase_S9
Block| X
Position in NCBI Life Tree|Agrobacterium tumefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Rhizobium/Agrobacterium group: N E > Agrobacterium: N E > Agrobacterium tumefaciens complex: N E > Agrobacterium tumefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AE007886
1 UniProt : Q7D3T6
1 UniProt : Q7D3T6
1 Interpro : Q7D3T6
1 Pfam : Q7D3T6
1 PIRSF : Q7D3T6
1 SUPERFAM : Q7D3T6
Sequence
Graphical view for this peptide sequence: agrt5-q7d3t6
Colored MSA for Prolyl_oligopeptidase_S9 (raw)
MTAMAEVTEHTIDRGDGARVQLFQARASDRRNGAILFVHGNQGGLLLGGQ
EAVEDGSLVRFSSRLGITAAAVSQPGFGTSDGPADFCGPSTQKAIVAALD
FLKRQPSVDPERIVLYGNSRGAVASAMVATKVADLKAIILTGGVYDLRDA
YKTSARGLQEAIRNEAGISDEAFLDRSALYHAHSIRSETLLLHGKYDDRA
SVDQAERFSEALARSGVPVRFHALDGGHRLPRDQVTPILRDFLTRVFAPM
ATIH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTAMAEVTEHTIDRGDGARVQLFQARASDRRNGAILFVHGNQGGLLLGGQ
EAVEDGSLVRFSSRLGITAAAVSQPGFGTSDGPADFCGPSTQKAIVAALD
FLKRQPSVDPERIVLYGNSRGAVASAMVATKVADLKAIILTGGVYDLRDA
YKTSARGLQEAIRNEAGISDEAFLDRSALYHAHSIRSETLLLHGKYDDRA
SVDQAERFSEALARSGVPVRFHALDGGHRLPRDQVTPILRDFLTRVFAPM
ATIH


Reference
    Title: Genome sequence of the plant pathogen and biotechnology agent Agrobacterium tumefaciens C58
    Goodner B, Hinkle G, Gattung S, Miller N, Blanchard M, Qurollo B, Goldman BS, Cao Y, Askenazi M and Slater S <21 more author(s)>
    Ref: Science, 294:2323, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer