Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: agrtu-ATU1045

Agrobacterium tumefaciens (strain C58 / ATCC 33970) hypothetical protein atu1045

Comment
Long N-term extension Glyoxalase 1 266


Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Agrobacterium tumefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Rhizobium/Agrobacterium group: N E > Agrobacterium: N E > Agrobacterium tumefaciens complex: N E > Agrobacterium tumefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AE009068, AE008035, NP_354068
1 UniProt : A9CJK0
1 UniProt : A9CJK0
1 Interpro : A9CJK0
1 Prodom : A9CJK0
1 Pfam : A9CJK0
1 PIRSF : A9CJK0
1 SUPERFAM : A9CJK0
Sequence
Graphical view for this peptide sequence: agrtu-ATU1045
Colored MSA for LYsophospholipase_carboxylesterase (raw)
APGMTVDEPLATLGEELFIPPLFMKDEADVRVALPQFAMPGEERIVYRDL
PFVHRFYTPEEPDGSTIILLHGSGGSETSLMPLAHRAAPGATLLGVRGRS
TEEDIARWFRRFPDFSFDQKDILLEAEAFAAFVEGAIRAYGLDRSKLRFI
GHSNGANFYAAFAALYPELAGDALLYRPMPVLETWPQSDLSGRNFVLVAG
ERDKYRDGASELQGRLTASGARAEVETVEDGHELGLPDLEAARRWLSDAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

APGMTVDEPLATLGEELFIPPLFMKDEADVRVALPQFAMPGEERIVYRDL
PFVHRFYTPEEPDGSTIILLHGSGGSETSLMPLAHRAAPGATLLGVRGRS
TEEDIARWFRRFPDFSFDQKDILLEAEAFAAFVEGAIRAYGLDRSKLRFI
GHSNGANFYAAFAALYPELAGDALLYRPMPVLETWPQSDLSGRNFVLVAG
ERDKYRDGASELQGRLTASGARAEVETVEDGHELGLPDLEAARRWLSDAS


References
    Title: Genome sequence of the plant pathogen and biotechnology agent Agrobacterium tumefaciens C58
    Goodner B, Hinkle G, Gattung S, Miller N, Blanchard M, Qurollo B, Goldman BS, Cao Y, Askenazi M and Slater S <21 more author(s)>
    Ref: Science, 294:2323, 2001 : PubMed

            

    Title: The genome of the natural genetic engineer Agrobacterium tumefaciens C58
    Wood DW, Setubal JC, Kaul R, Monks DE, Kitajima JP, Okura VK, Zhou Y, Chen L, Wood GE and Nester EW <41 more author(s)>
    Ref: Science, 294:2317, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer