(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Alphaproteobacteria: NE > Rhizobiales: NE > Rhizobiaceae: NE > Rhizobium/Agrobacterium group: NE > Agrobacterium: NE > Agrobacterium tumefaciens complex: NE > Agrobacterium tumefaciens: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Agrobacterium tumefaciens str. C58: N, E.
Agrobacterium fabrum str. C58: N, E.
Agrobacterium radiobacter: N, E.
Agrobacterium tumefaciens F2: N, E.
Agrobacterium tumefaciens str. Cherry 2E-2-2: N, E.
Agrobacterium radiobacter DSM 30147: N, E.
Agrobacterium tumefaciens 5A: N, E.
Agrobacterium tumefaciens GW4: N, E.
Rhizobium radiobacter: N, E.
Agrobacterium tumefaciens (strain apple 185): N, E.
Agrobacterium radiobacter K84: N, E.
Agrobacterium tumefaciens LBA4213 (Ach5): N, E.
Agrobacterium tumefaciens str. Kerr 14: N, E.
Agrobacterium tumefaciens str. CFBP 5621: N, E.
Agrobacterium tumefaciens str. CFBP 5771: N, E.
Agrobacterium tumefaciens CCNWGS0286: N, E.
Rhizobium nepotum 39/7: N, E.
Agrobacterium arsenijevicii: N, E.
Agrobacterium sp. SUL3: N, E.
Rhizobium sp. Root651: N, E.
Agrobacterium genomosp. 3 str. CFBP 6623: N, E.
Agrobacterium genomosp. 13 str. CFBP 6927: N, E.
Agrobacterium deltaense NCPPB 1641: N, E.
Rhizobium rubi NBRC 13261: N, E.
Rhizobium sp. H41: N, E.
Rhizobium sp. UR51a: N, E.
Rhizobium sp. Leaf262: N, E.
Rhizobium sp. Leaf311: N, E.
Rhizobium sp. Root491: N, E.
Agrobacterium sp. D14: N, E.
Agrobacterium sp. LY4: N, E.
Agrobacterium sp. R89-1: N, E.
Rhizobium rhizogenes NBRC 13257: N, E.
Agrobacterium rhizogenes: N, E.
Agrobacterium rubi: N, E.
Agrobacterium rubi TR3 = NBRC 13261: N, E.
Rhizobium sp. NFACC06-2: N, E.
Rhizobium pusense: N, E.
Agrobacterium sp. DSM 25558: N, E.
Agrobacterium sp. DSM 25559: N, E.
Agrobacterium genomosp. 2 str. CFBP 5494: N, E.
Agrobacterium genomosp. 1 str. TT111: N, E.
Agrobacterium genomosp. 1 str. S56: N, E.
Agrobacterium genomosp. 5 str. CFBP 6626: N, E.
Agrobacterium fabrum str. J-07: N, E.
Agrobacterium deltaense RV3: N, E.
Agrobacterium deltaense Zutra 3/1: N, E.
Agrobacterium salinitolerans str. Hayward 0363: N, E.
Agrobacterium sp. H13-3: N, E.
Agrobacterium sp. ATCC 31749: N, E.
Rhizobium sp. CF142: N, E.
Bradyrhizobium lupini HPC(L): N, E.
Rhizobium sp. IRBG74: N, E.
Molecular evidence
Database
No mutation 1 structure: 2I3D: Crystal structure of hypothetical protein Atu1826, a putative alpha/beta hydrolase from Agrobacterium tumefaciens. No kinetic
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MPEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLF YLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSK SCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGL IINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELM GECEDYLDRRLNGELVPEPAAKRIR
Agrobacterium tumefaciens is a plant pathogen capable of transferring a defined segment of DNA to a host plant, generating a gall tumor. Replacing the transferred tumor-inducing genes with exogenous DNA allows the introduction of any desired gene into the plant. Thus, A. tumefaciens has been critical for the development of modern plant genetics and agricultural biotechnology. Here we describe the genome of A. tumefaciens strain C58, which has an unusual structure consisting of one circular and one linear chromosome. We discuss genome architecture and evolution and additional genes potentially involved in virulence and metabolic parasitism of host plants.
The 5.67-megabase genome of the plant pathogen Agrobacterium tumefaciens C58 consists of a circular chromosome, a linear chromosome, and two plasmids. Extensive orthology and nucleotide colinearity between the genomes of A. tumefaciens and the plant symbiont Sinorhizobium meliloti suggest a recent evolutionary divergence. Their similarities include metabolic, transport, and regulatory systems that promote survival in the highly competitive rhizosphere; differences are apparent in their genome structure and virulence gene complement. Availability of the A. tumefaciens sequence will facilitate investigations into the molecular basis of pathogenesis and the evolutionary divergence of pathogenic and symbiotic lifestyles.
Agrobacterium tumefaciens complex Rhizobium radiobacter (Agrobacterium radiobacter) hypothetical protein atu1826
