Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: agrtu-ATU1826

Agrobacterium tumefaciens complex Rhizobium radiobacter (Agrobacterium radiobacter) hypothetical protein atu1826

Comment
Other strains: Agrobacterium tumefaciens complex Rhizobium radiobacter (Agrobacterium tumefaciens) (C58 / ATCC 33970; Kerr 14; CFBP 5621; LBA4213; CFBP 5771; Cherry 2E-2-2); Rhizobium nepotum 39/7; Agrobacterium arsenijevicii; Agrobacterium sp.; Rhizobium sp.; Agrobacterium genomosp.; Rhizobium rubi NBRC 13261; Agrobacterium rhizogenes; Rhizobium pusense; Agrobacterium fabrum str. J-07; Bradyrhizobium lupini (HPC(L); H13-3); Agrobacterium radiobacter (DSM 30147; H13-3; Ach5) (Agrobacterium radiobacter)


Relationship
Family|Atu1826-like
Block| X
Position in NCBI Life Tree|Agrobacterium tumefaciens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Rhizobiaceae: N E > Rhizobium/Agrobacterium group: N E > Agrobacterium: N E > Agrobacterium tumefaciens complex: N E > Agrobacterium tumefaciens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
2I3D: Crystal structure of hypothetical protein Atu1826, a putative alpha/beta hydrolase from Agrobacterium tumefaciens.
No kinetic





No Substrate
No inhibitor
>3 Genbank links 13 more: AE007869, AE008102, WP_020012833
1 UniProt : A9CIK7
1 Structure : 2I3D
>3 UniProt links 39 more: A9CIK7, A0A024IYY0, A0A0D8KA00
>3 Interpro links 39 more: A9CIK7, A0A024IYY0, A0A0D8KA00
>3 Prodom links 39 more: A9CIK7, A0A024IYY0, A0A0D8KA00
>3 Pfam links 39 more: A9CIK7, A0A024IYY0, A0A0D8KA00
>3 PIRSF links 39 more: A9CIK7, A0A024IYY0, A0A0D8KA00
>3 SUPERFAM links 39 more: A9CIK7, A0A024IYY0, A0A0D8KA00
Sequence
Graphical view for this peptide sequence: agrtu-ATU1826
Colored MSA for Atu1826-like (raw)
MPEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLF
YLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSK
SCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGL
IINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELM
GECEDYLDRRLNGELVPEPAAKRIR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPEVIFNGPAGRLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLF
YLFQKRGFTTLRFNFRSIGRSQGEFDHGAGELSDAASALDWVQSLHPDSK
SCWVAGYSFGAWIGMQLLMRRPEIEGFMSIAPQPNTYDFSFLAPCPSSGL
IINGDADKVAPEKDVNGLVEKLKTQKGILITHRTLPGANHFFNGKVDELM
GECEDYLDRRLNGELVPEPAAKRIR


References
    Title: Genome sequence of the plant pathogen and biotechnology agent Agrobacterium tumefaciens C58
    Goodner B, Hinkle G, Gattung S, Miller N, Blanchard M, Qurollo B, Goldman BS, Cao Y, Askenazi M and Slater S <21 more author(s)>
    Ref: Science, 294:2323, 2001 : PubMed

            

    Title: The genome of the natural genetic engineer Agrobacterium tumefaciens C58
    Wood DW, Setubal JC, Kaul R, Monks DE, Kitajima JP, Okura VK, Zhou Y, Chen L, Wood GE and Nester EW <41 more author(s)>
    Ref: Science, 294:2317, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer