Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ailme-g1mc29

Ailuropoda melanoleuca (Giant panda) Uncharacterized protein

Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Ailuropoda melanoleuca
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Carnivora: N E > Caniformia: N E > Ursidae: N E > Ailuropoda: N E > Ailuropoda melanoleuca: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ACTA01107016, ACTA01115016
1 UniProt : G1MC29
1 UniProt : G1MC29
1 Interpro : G1MC29
1 Pfam : G1MC29
1 PIRSF : G1MC29
1 SUPERFAM : G1MC29
Sequence
Graphical view for this peptide sequence: ailme-g1mc29
Colored MSA for Neuroligin (raw)
GSSQCGHEGAACRADAVTLESAFPASPPARNMWLRLGPPSLSLSPKSTVG
QSLCLTLWFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQY
LGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVML
PVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKIC
RKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMI
DGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVS
ENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALS
SWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPAR
YHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVD
PEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPET
RRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWS
DAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGD
PNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRAT
KVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWST
KRPAISPAYSNENAQGSWNRDQDAGPLLVENPRDYSTELSVTIAVGASLL
FLNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLG
PTHHECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLV
GLQTLHPYNTFATGFNSTGLPHSHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GSSQCGHEGAACRADAVTLESAFPASPPARNMWLRLGPPSLSLSPKSTVG
QSLCLTLWFLSLVLRASTQAPAPTVNTHFGKLRGARVPLPSEILGPVDQY
LGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVML
PVWFTANLDIVATYIQEPNEDCLYLNVYVPTEDVKRISKECARKPNKKIC
RKGGSGAKKQGEDLADNDGDEDEDIRDSGAKPVMVYIHGGSYMEGTGNMI
DGSVLASYGNVIVITLNYRVGVLGFLSTGDQAAKGNYGLLDQIQALRWVS
ENIAFFGGDPRRITVFGSGIGASCVSLLTLSHHSEGLFQRAIIQSGSALS
SWAVNYQPVKYTSLLADKVGCNVLDTVDMVDCLRQKSAKELVEQDIQPAR
YHVAFGPVIDGDVIPDDPEILMEQGEFLNYDIMLGVNQGEGLKFVEGVVD
PEDGVSGTDFDYSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADRDNPET
RRKTLVALFTDHQWVEPSVVTADLHARYGSPTYFYAFYHHCQSLMKPAWS
DAAHGDEVPYVFGVPMVGPTDLFPCNFSKNDVMLSAVVMTYWTNFAKTGD
PNKPVPQDTKFIHTKANRFEEVAWSKYNPRDQLYLHIGLKPRVRDHYRAT
KVAFWKHLVPHLYNLHDMFHYTSTTTKVPPPDTTHSSHITRRPNGKTWST
KRPAISPAYSNENAQGSWNRDQDAGPLLVENPRDYSTELSVTIAVGASLL
FLNVLAFAALYYRKDKRRQEPLRQPSPQRGAGAPELGAAPEEELAALQLG
PTHHECEAGPPHDTLRLTALPDYTLTLRRSPDDIPLMTPNTITMIPNSLV
GLQTLHPYNTFATGFNSTGLPHSHSTTRV


Reference
    Title: The sequence and de novo assembly of the giant panda genome
    Li R, Fan W, Tian G, Zhu H, He L, Cai J, Huang Q, Cai Q, Li B and Yang H <103 more author(s)>
    Ref: Nature, 463:311, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer