Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ajecg-c0nst6

Ajellomyces capsulata (Darling's disease fungus) (Histoplasma capsulatum) Putative uncharacterized protein

Comment
Other strians: Ajellomyces capsulata (strain G186AR / H82 / ATCC MYA-2454 / RMSC 2432; H143; H88; NAm1 / WU24) (Darling's disease fungus) (Histoplasma capsulatum)


Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Ajellomyces capsulata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Onygenales: N E > Ajellomycetaceae: N E > Histoplasma: N E > Histoplasma capsulatum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: GG663370, GG692423, DS990643
>3 UniProt links 1 more: C0NST6, C6HE72, F0UUV7
>3 UniProt links 1 more: C0NST6, C6HE72, F0UUV7
>3 Interpro links 1 more: C0NST6, C6HE72, F0UUV7
>3 Prodom links 1 more: C0NST6, C6HE72, F0UUV7
>3 Pfam links 1 more: C0NST6, C6HE72, F0UUV7
>3 PIRSF links 1 more: C0NST6, C6HE72, F0UUV7
>3 SUPERFAM links 1 more: C0NST6, C6HE72, F0UUV7
Sequence
Graphical view for this peptide sequence: ajecg-c0nst6
Colored MSA for Prolylcarboxypeptidase (raw)
MAIQSVAVFRLALLFAFMQLAVASIRVDWQDPLSIPRPETDDADLKARYP
VHKFKTLIDHFPSDPRYEPHTGEKFDLRYWFDASHYKKGGPVIVLHGGEA
NGEGRLPFLQKGIVKILSEATHGLGVILEHRYYGQSFPTANLSTESLRFL
TTEQALADSADFAQNVVFEGFEDVDLTAKGGNAPWIAYGGSYAGAQVAFL
RAQYPDIFWGAISSSGVTKAIYDYWEYFEPVRKYGPPECVSTTQKFVDMV
DTIIIGLSDPKKTKRLKSFFGLEGLTHNDDFANVLAWGISYWQSVNWDPK
ISTRKFDYYCGNITADELLYGNGDLKDEAEELLIAGGYGKEVGTLANRLL
NFAGFLHHDQLVYCKETEQTMDECLGQHDMAWFKNDSLAQADNRCWPYQV
CTEWGFLQVGSTVPQDQMPMVSRLIDLEYASIMCREAFGIYRPSDVNRVN
KYGGFDIEYERLAFIDGEVDPWRPATPHSEMARPRKSTLEKPFILIEGAG
HHWDENGMLANESTPMLPPKAVADAQAQEVKFVKKWMKDWEQELRQRLTN
KQTMISHGD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAIQSVAVFRLALLFAFMQLAVASIRVDWQDPLSIPRPETDDADLKARYP
VHKFKTLIDHFPSDPRYEPHTGEKFDLRYWFDASHYKKGGPVIVLHGGEA
NGEGRLPFLQKGIVKILSEATHGLGVILEHRYYGQSFPTANLSTESLRFL
TTEQALADSADFAQNVVFEGFEDVDLTAKGGNAPWIAYGGSYAGAQVAFL
RAQYPDIFWGAISSSGVTKAIYDYWEYFEPVRKYGPPECVSTTQKFVDMV
DTIIIGLSDPKKTKRLKSFFGLEGLTHNDDFANVLAWGISYWQSVNWDPK
ISTRKFDYYCGNITADELLYGNGDLKDEAEELLIAGGYGKEVGTLANRLL
NFAGFLHHDQLVYCKETEQTMDECLGQHDMAWFKNDSLAQADNRCWPYQV
CTEWGFLQVGSTVPQDQMPMVSRLIDLEYASIMCREAFGIYRPSDVNRVN
KYGGFDIEYERLAFIDGEVDPWRPATPHSEMARPRKSTLEKPFILIEGAG
HHWDENGMLANESTPMLPPKAVADAQAQEVKFVKKWMKDWEQELRQRLTN
KQTMISHGD


Reference
    Title: Comparative genomic analyses of the human fungal pathogens Coccidioides and their relatives
    Sharpton TJ, Stajich JE, Rounsley SD, Gardner MJ, Wortman JR, Jordar VS, Maiti R, Kodira CD, Neafsey DE and Taylor JW <14 more author(s)>
    Ref: Genome Res, 19:1722, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer