Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: alcbs-q0vl36

Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573), EH118 Putative uncharacterized protein

Comment
EH118 promiscuous activity 6/96 substrates Martinez-Martinez et al. 2018 , CE10 in Bollinger et al. 2020 . only c-term Pfam Lipase_2 86 276


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Alcanivorax borkumensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Alcanivoracaceae: N E > Alcanivorax: N E > Alcanivorax borkumensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AM286690, WP_011589935, CAL18112
1 UniProt : Q0VL36
1 UniProt : Q0VL36
1 Interpro : Q0VL36
1 Pfam : Q0VL36
1 PIRSF : Q0VL36
1 SUPERFAM : Q0VL36
Sequence
Graphical view for this peptide sequence: alcbs-q0vl36
Colored MSA for 6_AlphaBeta_hydrolase (raw)
LPTLLGMAKEAAALTVLVLSYPLRLIHDSSPVRSRHHGEPPVILVHGYGG
NSANFLFMQWRLKWRGWSNVYSVSYTPPHINARKLSQQVVDHVERILATT
GAEKAHLVCHSMGGPLTRYALKNLGLAGKVDRVITLGSPHYGTRVAGLFP
PLGAAAQLRYQSPFIRELATEATCPGGARYFSIFSNMDNFVLPVSAAVLH
GAEDNIHVPYLGHCSLLYSSRVMDQVERCLLAPPKAAE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

LPTLLGMAKEAAALTVLVLSYPLRLIHDSSPVRSRHHGEPPVILVHGYGG
NSANFLFMQWRLKWRGWSNVYSVSYTPPHINARKLSQQVVDHVERILATT
GAEKAHLVCHSMGGPLTRYALKNLGLAGKVDRVITLGSPHYGTRVAGLFP
PLGAAAQLRYQSPFIRELATEATCPGGARYFSIFSNMDNFVLPVSAAVLH
GAEDNIHVPYLGHCSLLYSSRVMDQVERCLLAPPKAAE


References
    Title: Organic-Solvent-Tolerant Carboxylic Ester Hydrolases for Organic Synthesis
    Bollinger A, Molitor R, Thies S, Koch R, Coscolin C, Ferrer M, Jaeger KE
    Ref: Applied Environmental Microbiology, 86:e00106, 2020 : PubMed

            

    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Genome sequence of the ubiquitous hydrocarbon-degrading marine bacterium Alcanivorax borkumensis
    Schneiker S, Martins dos Santos VA, Bartels D, Bekel T, Brecht M, Buhrmester J, Chernikova TN, Denaro R, Ferrer M and Golyshin PN <20 more author(s)>
    Ref: Nat Biotechnol, 24:997, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer