Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: alcbs-q0vlq1

Alcanivorax borkumensis (strain SK2 / ATCC 700651 / DSM 11573) Alcanivorax sp. DG881, ABO2449 EH83 polyacetic acid hydrolase

Comment
EH83promiscuous activity 14/96 substrates Martinez-Martinez et al. 2018 , CE06 in Bollinger et al. 2020


Relationship
Family|Aclacinomycin-methylesterase_RdmC
Block| X
Position in NCBI Life Tree|Alcanivorax borkumensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Oceanospirillales: N E > Alcanivoracaceae: N E > Alcanivorax: N E > Alcanivorax borkumensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Polylactic-acid
No inhibitor
3 Genbank : AM286690, DS989915, CAL17897
2 UniProt : Q0VLQ1, B4X4K6
2 UniProt : Q0VLQ1, B4X4K6
2 Interpro : Q0VLQ1, B4X4K6
2 Prodom : Q0VLQ1, B4X4K6
2 Pfam : Q0VLQ1, B4X4K6
2 PIRSF : Q0VLQ1, B4X4K6
2 SUPERFAM : Q0VLQ1, B4X4K6
Sequence
Graphical view for this peptide sequence: alcbs-q0vlq1
Colored MSA for Aclacinomycin-methylesterase_RdmC (raw)
MQSGTVASNGIELFYESRGPENGEPMVFVMGLSAQMVFWPDTLLDALAAK
GYRVIRFDNRDVGKSTQIRKPIKQGPVSAILRRIIGLPVESPYTLHDMVA
DTVGLLDALNIERAHFVGASMGGMISQLMAGTHPERVLSLTSIMSSNNSS
LLPPPKPSALRVLIAPRVKVETEEQFVTFGLEMMSKLAGTLPQGKEELAA
MYRAAWARGINPRGIRNQFLAITATGSLSKTLKQIQCPTTVIHGGADPLI
RPAGGKASARAIRGAKLVIIPGMGHDFPPSVIDRIGELIAETAGRANSVV
PPAVG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQSGTVASNGIELFYESRGPENGEPMVFVMGLSAQMVFWPDTLLDALAAK
GYRVIRFDNRDVGKSTQIRKPIKQGPVSAILRRIIGLPVESPYTLHDMVA
DTVGLLDALNIERAHFVGASMGGMISQLMAGTHPERVLSLTSIMSSNNSS
LLPPPKPSALRVLIAPRVKVETEEQFVTFGLEMMSKLAGTLPQGKEELAA
MYRAAWARGINPRGIRNQFLAITATGSLSKTLKQIQCPTTVIHGGADPLI
RPAGGKASARAIRGAKLVIIPGMGHDFPPSVIDRIGELIAETAGRANSVV
PPAVG


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Biochemical and Structural Insights into Enzymatic Depolymerization of Polylactic Acid and Other Polyesters by Microbial Carboxylesterases
    Hajighasemi M, Nocek BP, Tchigvintsev A, Brown G, Flick R, Xu X, Cui H, Hai T, Joachimiak A and Yakunin AF <3 more author(s)>
    Ref: Biomacromolecules, 17:2027, 2016 : PubMed

            

    Title: Genome sequence of the ubiquitous hydrocarbon-degrading marine bacterium Alcanivorax borkumensis
    Schneiker S, Martins dos Santos VA, Bartels D, Bekel T, Brecht M, Buhrmester J, Chernikova TN, Denaro R, Ferrer M and Golyshin PN <20 more author(s)>
    Ref: Nat Biotechnol, 24:997, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer