Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: amymu-d8hu87

Amycolatopsis mediterranei; Amycolatopsis rifamycinica; Amycolatopsis tolypomycina; Amycolatopsis pretoriensis; Amycolatopsis thailandensis; Amycolatopsis sp.; Amycolatopsis balhimycina; Amycolatopsis vancoresmycina Putative secreted tripeptidyl aminopeptidase

Comment
Other strains: Amycolatopsis mediterranei (strain U-32; S699, Nocardia mediterranei); Amycolatopsis rifamycinica; Amycolatopsis tolypomycina; Amycolatopsis pretoriensis; Amycolatopsis thailandensis; Amycolatopsis sp.; Amycolatopsis balhimycina DSM 5908; Amycolatopsis vancoresmycina DSM 44592


Relationship
Family|Peptidase_S37
Block| X
Position in NCBI Life Tree|Amycolatopsis mediterranei
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Amycolatopsis: N E > Amycolatopsis mediterranei: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: amymu-d8hu87
Colored MSA for Peptidase_S37 (raw)
MRRLFTAGAVLLALAGLAPAAAAAPDIKAQLQRIPGLTIVSEDAAPAGFR
FFKLTYTQPADHRHPGAGTFQQRFTLLHRDFAAPTVAFTSGYNVSGSPNR
SEPTQIVDGNQLSMEYRYFTPSRPEPENWAKQLTIWQAAADEHRAVQAFK
AIYPGKWLATGGSKGGMTATYFRRFFPDDVDATIPYVAPNDVIDPIDVYN
RFLSRVGDDPACRDALKAIQRDALKRRDELGPIAAADAAQRGLTFSIVGS
ADKSLEISVIDSYFAFWQYQKQADCATVPPAGAPAADVYAWYEKVESLNT
YSDQDLAPYIPYYYQAAVQLGSPEAYDGYLRDLLRYPGADQPKTFVPASI
RLPRFDYLAMPDIDFWVKSRGTRLLFVYGANDPWGAEPFELGFGSRDSYR
YYVQGGNHGSKIAQLAPPDAAAATATVRRWAGLPPVAPLAARSAPAGFPD
FDTDLTPRARL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRRLFTAGAVLLALAGLAPAAAAAPDIKAQLQRIPGLTIVSEDAAPAGFR
FFKLTYTQPADHRHPGAGTFQQRFTLLHRDFAAPTVAFTSGYNVSGSPNR
SEPTQIVDGNQLSMEYRYFTPSRPEPENWAKQLTIWQAAADEHRAVQAFK
AIYPGKWLATGGSKGGMTATYFRRFFPDDVDATIPYVAPNDVIDPIDVYN
RFLSRVGDDPACRDALKAIQRDALKRRDELGPIAAADAAQRGLTFSIVGS
ADKSLEISVIDSYFAFWQYQKQADCATVPPAGAPAADVYAWYEKVESLNT
YSDQDLAPYIPYYYQAAVQLGSPEAYDGYLRDLLRYPGADQPKTFVPASI
RLPRFDYLAMPDIDFWVKSRGTRLLFVYGANDPWGAEPFELGFGSRDSYR
YYVQGGNHGSKIAQLAPPDAAAATATVRRWAGLPPVAPLAARSAPAGFPD
FDTDLTPRARL


Reference
    Title: Complete genome sequence of the rifamycin SV-producing Amycolatopsis mediterranei U32 revealed its genetic characteristics in phylogeny and metabolism
    Zhao W, Zhong Y, Yuan H, Wang J, Zheng H, Wang Y, Cen X, Xu F, Bai J and Zhao GP <16 more author(s)>
    Ref: Cell Res, 20:1096, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer