Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anapl-lcat

Anas platyrhynchos (Domestic duck) lecithin cholesterol acyltransferase

Comment
This entry also contains links to numerous short sequences of birds sequenced for evolution studies: Sarkidiornis melanotos (Comb duck), Tachyeres patachonicus, Anas platyrhynchos (Domestic duck) (Anas boschas), Callonetta leucophrys, Chloephaga melanoptera (Andean goose), Chenonetta jubata (Australian wood duck), Branta bernicla (Brent goose) (Anas bernicla), Cygnus olor (Mute swan) (Anas olor), Anas carolinensis (Green-winged teal), Tachyeres brachypterus, Aix sponsa (Wood duck), Merganetta armata, Anas americana (American widgeon), Hymenolaimus malacorhynchos, Tachyeres leucocephalus, Lophonetta specularioides (Crested duck) (Anas specularioides), Tadorna tadorna (common shelduck), Tachyeres pteneres, Marmaronetta angustirostris (Marbled teal), Speculanas specularis, Alopochen aegyptiaca (Egyptian goose), Pteronetta hartlaubi, Amazonetta brasiliensis (Brazilian teal), Aythya americana (Redhead), Anas crecca crecca, Neochen jubata (Orinoco goose) (Anser jubatus), Cyanochen cyanoptera (Blue-winged goose), Asarcornis scutulata, Anas clypeata (Northern shoveler), Cairina moschata (Muscovy duck), Anas acuta (Northern pintail)


Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Anas platyrhynchos
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Galloanserae: N E > Anseriformes: N E > Anatidae: N E > Anas: N E > Anas platyrhynchos: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF324887
>3 UniProt links 28 more: D6R3K8, D6R3J8, Q9DDJ6
>3 UniProt links 28 more: Q9DDJ6, D6R3K8, D6R3J8
>3 Interpro links 28 more: Q9DDJ6, D6R3K8, D6R3J8
>3 Pfam links 28 more: Q9DDJ6, D6R3K8, D6R3J8
>3 PIRSF links 28 more: Q9DDJ6, D6R3K8, D6R3J8
>3 SUPERFAM links 28 more: Q9DDJ6, D6R3K8, D6R3J8
Sequence
Graphical view for this peptide sequence: anapl-lcat
Colored MSA for PC-sterol_acyltransferase (raw)
MGRTGAGFALLTLLLLLPQPASQFWLFNVLFPPTSTPEAPPTNSTPPVVL
VPGCLGNQLEAKLDKPDVVNWMCYRKTEDYFTIWLNLNTFLPVGVDCWID
NTRVVYNRTSRKMSNAPGVHIRVPGFGKTYSVEYLDQSKLAGYLHTLVQN
LVNNGYVRDQTVRAAPYDWRVGPQEQPEYFQNLKALIEEMHDEYQQRVFL
IAHSMGNLNVLYFLLQQRQAWKDQYIGGFISLGAPWGGSVKPLRVLASGD
NQGIPLMSNIKLREEQRMTTTSPWMFPTSLAWPEDHIFISTPSYNYTYRD
YKQFFTDVNLEDGWYMWEDMKDLLKGLPPPGVDTYCLYGTGYPTVETYIY
DEHFPYEDPVDMIYGDGDDTVNRRSSELCKRWRNQQKQKVHIQELRGIDH
LNMVFSNLTLSSINEILLGSSQVGAGTKEHGELGQMGALKSSLEAGRRGK
N
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGRTGAGFALLTLLLLLPQPASQFWLFNVLFPPTSTPEAPPTNSTPPVVL
VPGCLGNQLEAKLDKPDVVNWMCYRKTEDYFTIWLNLNTFLPVGVDCWID
NTRVVYNRTSRKMSNAPGVHIRVPGFGKTYSVEYLDQSKLAGYLHTLVQN
LVNNGYVRDQTVRAAPYDWRVGPQEQPEYFQNLKALIEEMHDEYQQRVFL
IAHSMGNLNVLYFLLQQRQAWKDQYIGGFISLGAPWGGSVKPLRVLASGD
NQGIPLMSNIKLREEQRMTTTSPWMFPTSLAWPEDHIFISTPSYNYTYRD
YKQFFTDVNLEDGWYMWEDMKDLLKGLPPPGVDTYCLYGTGYPTVETYIY
DEHFPYEDPVDMIYGDGDDTVNRRSSELCKRWRNQQKQKVHIQELRGIDH
LNMVFSNLTLSSINEILLGSSQVGAGTKEHGELGQMGALKSSLEAGRRGK
N


Reference
    Title: Phylogenetic relationships of Amazonetta, Speculanas, Lophonetta, and Tachyeres: four morphologically divergent duck genera endemic to South America
    Bulgarella M, Sorenson MD, Peters JL, Wilson RE, McCracken KG
    Ref: J Avian Biol, 41:186, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer