Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anasp-ALL4875

Anabaena sp. (strain PCC 7120) hypothetical protein all4875

Relationship
Family|Chlorophyllase
Block| L
Position in NCBI Life Tree|Anabaena sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Nostocales: N E > Nostocaceae: N E > Anabaena: N E > Anabaena sp.: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP003597
1 UniProt : Q8YMQ8
1 Interpro : Q8YMQ8
1 Prodom : Q8YMQ8
1 Pfam : Q8YMQ8
1 PIRSF : Q8YMQ8
1 SUPERFAM : Q8YMQ8
Sequence
Graphical view for this peptide sequence: anasp-ALL4875
Colored MSA for Chlorophyllase (raw)
MQTVQALLTAAKVDGAKSPYDTIHIKVLYPAKNTDSNLEKSWGMLPIDTA
QAPLPVMIFFNGFNCDAQKYQWLGIELAQTGLVVVMFNWVGESLPGLVSF
TPGFEIEKRKREFYGTAPTASALPAILTTLAQLQREGILAGTLDLEKIIL
GGHSEGGRVAMENANPNFFPQVVASFAYGSHTAGAVMLGYKPNTILPLPD
TLPRLVIGGTHDGVIASSSSHFGLNTKDATTPVIRTFQEAIMGGHENSYL
LILRGANHFSIVDIVDSTLALPFKDIPATQPQEHFRLLLATIIHLFIDAH
VRHQPEAFQKLEQLLIVTNPLIQSFERK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQTVQALLTAAKVDGAKSPYDTIHIKVLYPAKNTDSNLEKSWGMLPIDTA
QAPLPVMIFFNGFNCDAQKYQWLGIELAQTGLVVVMFNWVGESLPGLVSF
TPGFEIEKRKREFYGTAPTASALPAILTTLAQLQREGILAGTLDLEKIIL
GGHSEGGRVAMENANPNFFPQVVASFAYGSHTAGAVMLGYKPNTILPLPD
TLPRLVIGGTHDGVIASSSSHFGLNTKDATTPVIRTFQEAIMGGHENSYL
LILRGANHFSIVDIVDSTLALPFKDIPATQPQEHFRLLLATIIHLFIDAH
VRHQPEAFQKLEQLLIVTNPLIQSFERK


Reference
    Title: Complete genomic sequence of the filamentous nitrogen-fixing cyanobacterium Anabaena sp. strain PCC 7120
    Kaneko T, Nakamura Y, Wolk CP, Kuritz T, Sasamoto S, Watanabe A, Iriguchi M, Ishikawa A, Kawashima K and Tabata S <12 more author(s)>
    Ref: DNA Research, 8:205, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer