Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anavt-q3m300

Anabaena variabilis (strain ATCC 29413 / PCC 7937) lipase, class 2

Relationship
Family|Lipase_2
Block| X
Position in NCBI Life Tree|Anabaena variabilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Nostocales: N E > Nostocaceae: N E > Trichormus: N E > Trichormus variabilis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000117
1 UniProt : Q3M300
1 UniProt : Q3M300
1 Interpro : Q3M300
1 Pfam : Q3M300
1 PIRSF : Q3M300
1 SUPERFAM : Q3M300
Sequence
Graphical view for this peptide sequence: anavt-q3m300
Colored MSA for Lipase_2 (raw)
METRNLQRNPILLVHGITDTEAVFDQMAAYLRQMGWTVYTLNLVPNNGEA
PLNVLAQQVADYVAANITPEQPFDLVGFSMGGIVSRYYVQRLGGISHVQR
FVTISSPHYGTVIAYASQRPGCVQMRPNSLFLQDLNHDVQMLEELNFTSI
WTPYDLMIVPTHSSKMPVGKELSIPVALHSWMLRDVRSIEAVAAALAEPI
NCDRRFEYIPNSSIHN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METRNLQRNPILLVHGITDTEAVFDQMAAYLRQMGWTVYTLNLVPNNGEA
PLNVLAQQVADYVAANITPEQPFDLVGFSMGGIVSRYYVQRLGGISHVQR
FVTISSPHYGTVIAYASQRPGCVQMRPNSLFLQDLNHDVQMLEELNFTSI
WTPYDLMIVPTHSSKMPVGKELSIPVALHSWMLRDVRSIEAVAAALAEPI
NCDRRFEYIPNSSIHN



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer