Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: angja-1plip

Anguilla japonica (Japanese eel) triglyceride lipase (EC 3.1.1.3)

Relationship
Family|Pancreatic_lipase
Block| L
Position in NCBI Life Tree|Anguilla japonica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Elopocephalai: N E > Elopocephala: N E > Elopomorpha: N E > Anguilliformes: N E > Anguillidae: N E > Anguilla: N E > Anguilla japonica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB070722
1 UniProt : Q8QGW1
1 Interpro : Q8QGW1
1 Prodom : Q8QGW1
1 Pfam : Q8QGW1
1 PIRSF : Q8QGW1
1 SUPERFAM : Q8QGW1
Sequence
Graphical view for this peptide sequence: angja-1plip
Colored MSA for Pancreatic_lipase (raw)
MMSVVWILGLFLLGTASGAEVCYENLGCFTDDVPWAGTTERPIAKLPWSP
EKIGTRFMLFTRQNPNNHQEITTKEDILLASNYNGTRKTRFITHGYVDKG
DENWLIDMCKLMLQVEDINCICVDWKKGGRTLYTQSASNIRVIGAQMAYM
IQLFQKVYQQRPESVHIIGHSLGAHCAGEAGRRTPNLGRITGLDPAEPYF
QGCPSLVRLDPSDAKFVDVIHTDAKPMIPYLGMGMAQAVGHLDFYPNGGE
HMPGCDKNIISQTVDIDGIWEGTRDFVACNHLRSYKYYSDSILNPEGFTG
YPCSDGGVFESGRCFPCGDGACPFMGHHADKFRRPNGAEKMKFYLNTADA
KPFGRYRYKVTVTIRADRALLLTGTMSVAIYGTQGNTRQYQIRKGLLKPG
NTYEAYIDTETDAGEVTKMKFIWDNSVINPMFPKLGAEKIVLQRGKDRRI
FSFCSSETVREEMLQTVPPC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMSVVWILGLFLLGTASGAEVCYENLGCFTDDVPWAGTTERPIAKLPWSP
EKIGTRFMLFTRQNPNNHQEITTKEDILLASNYNGTRKTRFITHGYVDKG
DENWLIDMCKLMLQVEDINCICVDWKKGGRTLYTQSASNIRVIGAQMAYM
IQLFQKVYQQRPESVHIIGHSLGAHCAGEAGRRTPNLGRITGLDPAEPYF
QGCPSLVRLDPSDAKFVDVIHTDAKPMIPYLGMGMAQAVGHLDFYPNGGE
HMPGCDKNIISQTVDIDGIWEGTRDFVACNHLRSYKYYSDSILNPEGFTG
YPCSDGGVFESGRCFPCGDGACPFMGHHADKFRRPNGAEKMKFYLNTADA
KPFGRYRYKVTVTIRADRALLLTGTMSVAIYGTQGNTRQYQIRKGLLKPG
NTYEAYIDTETDAGEVTKMKFIWDNSVINPMFPKLGAEKIVLQRGKDRRI
FSFCSSETVREEMLQTVPPC


Reference
    Title: Expression of pancreatic enzyme genes during the early larval stage of Japanese eel, Anguilla japonica.
    Kurokawa T, Suzuki T, Ohta H, Kagawa H, Tanaka H, Unuma T
    Ref: Fish Sci, 68:736, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer