anoca-nlgn4

 
Anolis carolinensis (Green anole) (American chameleon) Neuroligin 4

Relationship
Family Neuroligin
Block C
Anolis carolinensis position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Lepidosauria: N E > Squamata: N E > Bifurcata: N E > Unidentata: N E > Episquamata: N E > Toxicofera: N E > Iguania: N E > Dactyloidae: N E > Anolis: N E > Anolis carolinensis: N E

Molecular evidence
Database
No mutation
No structure
No kinetic



1 Genbank : GQ489211
1 UniProt : D2X2I0
1 UniProtTrembl : D2X2I0
1 Interpro : D2X2I0
1 Prodom : D2X2I0
1 Pfam : D2X2I0
1 PIRSF : D2X2I0
1 SUPERFAM : D2X2I0
1 QuickSwissBlast : D2X2I0
 
Sequence
Graphical view for this peptide sequence: anoca-nlgn4
Colored MSA for Neuroligin (raw)
MSRPMGLLWLPLIFTPVCVMLNSNFLFWITALAIRFTLIDGQAQYPVVTT
NYGKIRGVRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGI
RNATQFAAVCPQYLDERSLLNDMLPVWFTANLDTVMTYVQDQNEDCLYLN
VYVPTEDGANTKKSADDITSNDRGEDEDIHDQNSKKPVMVYIHGGSYMEG
TGNIVDGSILASYGNVIVVTINYRLGVLGFLSTGDQAAKGNYGLLDQIQA
LRWIEENIGSFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQS
GTALSSWAVNYQPAKYTAILAEKVGCNTLDTTDLVECFRNKNYKELIQQT
ITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFV
DGIVDNEEGVSPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADK
ENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEM
KPSWADSAHGDEVPYVFGIPMIGPTELFNCNFSKNDVMLSAVVMTYWTNF
AKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRD
HYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDLTSFPYVTRRSPG
KFTTKRPLMTPSNNPKHSKDTQKTSPEDTSVLIENKRDYSTELSVTIAVG
ASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSL
QMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMI
PNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSRPMGLLWLPLIFTPVCVMLNSNFLFWITALAIRFTLIDGQAQYPVVTT
NYGKIRGVRTPLPNEILGPVEQYLGVPYASPPTGERRFQPPEPPSSWTGI
RNATQFAAVCPQYLDERSLLNDMLPVWFTANLDTVMTYVQDQNEDCLYLN
VYVPTEDGANTKKSADDITSNDRGEDEDIHDQNSKKPVMVYIHGGSYMEG
TGNIVDGSILASYGNVIVVTINYRLGVLGFLSTGDQAAKGNYGLLDQIQA
LRWIEENIGSFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQS
GTALSSWAVNYQPAKYTAILAEKVGCNTLDTTDLVECFRNKNYKELIQQT
ITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFV
DGIVDNEEGVSPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADK
ENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEM
KPSWADSAHGDEVPYVFGIPMIGPTELFNCNFSKNDVMLSAVVMTYWTNF
AKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRD
HYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDLTSFPYVTRRSPG
KFTTKRPLMTPSNNPKHSKDTQKTSPEDTSVLIENKRDYSTELSVTIAVG
ASLLFLNILAFAALYYKKDKRRHETHRRPSPQRNTTNDIAHIQNEEIMSL
QMKQLEHDHECESLQAHDTLRLTCPPDYTLTLRRSPDDIPLMTPNTITMI
PNTLTGMQPLHTFNTFSGGQNSTNLPHGHSTTRV

no DNA




Reference
    Title: Characterization of the neuroligin gene family expression and evolution in zebrafish
    Rissone A, Sangiorgio L, Monopoli M, Beltrame M, Zucchi I, Bussolino F, Arese M, Cotelli F
    Ref: Developmental Dynamics, 239:688, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer