Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anofw-b7glx5

Anoxybacillus flavithermus, Anoxybacillus thermarum, Anoxybacillus sp., Anoxybacillus ayderensis, Anoxybacillus gonensis. Esterase/lipase

Comment
Other strains: Anoxybacillus flavithermus (strain DSM 21510 / WK1; NBRC 109594; TNO-09.006; AK1) Anoxybacillus thermarum strain AF/04 ; Anoxybacillus sp. (KU2-6(11); BCO1; DT3-1; PDF1); Anoxybacillus ayderensis (AB04); Anoxybacillus gonensis


Relationship
Family|CarbLipBact_1
Block| X
Position in NCBI Life Tree|Anoxybacillus flavithermus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Anoxybacillus: N E > Anoxybacillus flavithermus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: anofw-b7glx5
Colored MSA for CarbLipBact_1 (raw)
MMKMIPPQPFTFEAGERAVLLLHGFTGNSADVRMLGRFLQSKGYTCHAPI
YKGHGVPPEELVHTGPEDWWQDVINAYEYLKQTHEKIAVVGLSLGGVFSL
KLGYTVPVVGIVPMCAPMYIKSEQTMYEGVLAYAREYKKREGKSEEQIER
EMAEFAKTPMKTLKALQQLIADVRDHLDFIYAPVFVVQARHDDMINPDSA
NIIYNGVESPVKQIKWYEESGHVITLDKEKEQLHEDIYAFLESLDW
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MMKMIPPQPFTFEAGERAVLLLHGFTGNSADVRMLGRFLQSKGYTCHAPI
YKGHGVPPEELVHTGPEDWWQDVINAYEYLKQTHEKIAVVGLSLGGVFSL
KLGYTVPVVGIVPMCAPMYIKSEQTMYEGVLAYAREYKKREGKSEEQIER
EMAEFAKTPMKTLKALQQLIADVRDHLDFIYAPVFVVQARHDDMINPDSA
NIIYNGVESPVKQIKWYEESGHVITLDKEKEQLHEDIYAFLESLDW


References
1 more
    Title: Analysis of anoxybacillus genomes from the aspects of lifestyle adaptations, prophage diversity, and carbohydrate metabolism
    Goh KM, Gan HM, Chan KG, Chan GF, Shahar S, Chong CS, Kahar UM, Chai KP
    Ref: PLoS ONE, 9:e90549, 2014 : PubMed

            

    Title: Complete Genome Sequence of Anoxybacillus flavithermus TNO-09.006, a Thermophilic Sporeformer Associated with a Dairy-Processing Environment
    Caspers MP, Boekhorst J, Abee T, Siezen RJ, Kort R
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Encapsulated in silica: genome, proteome and physiology of the thermophilic bacterium Anoxybacillus flavithermus WK1
    Saw JH, Mountain BW, Feng L, Omelchenko MV, Hou S, Saito JA, Stott MB, Li D, Zhao G and Alam M <8 more author(s)>
    Ref: Genome Biol, 9:R161, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer