Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anoga-q7qj95

Anopheles gambiae str. PEST ensangp00000018475 (fragment)

Relationship
Family|Insect_lipase
Block| L
Position in NCBI Life Tree|Anopheles gambiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Anophelinae: N E > Anopheles [genus]: N E > Cellia: N E > Pyretophorus: N E > gambiae species complex: N E > Anopheles gambiae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AAAB01008807
1 UniProt : Q7QJ95
1 UniProt : Q7QJ95
1 Interpro : Q7QJ95
1 Pfam : Q7QJ95
1 PIRSF : Q7QJ95
1 SUPERFAM : Q7QJ95
Sequence
Graphical view for this peptide sequence: anoga-q7qj95
Colored MSA for Insect_lipase (raw)
GCKPAEPFVVVVHGWTEGCSNTQWVRDTLNNFIIHRKGCILCLDYSVIAD
GNDYFTVAKLMEPIARTLEKKLRQLFTFGIAPASGMVYGFSLGAHVAFQA
GRNLAPQKLGRIDACDPVGIAFDKNDTYTALSVTDSATEVQCIHTSSDIG
TTRRDCHKDWIMGYCGWVQFAAGLKTSHELCPIFYNAAFWFDFKAVYNPY
VCPTSRAVSSWPAGFKMGY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

GCKPAEPFVVVVHGWTEGCSNTQWVRDTLNNFIIHRKGCILCLDYSVIAD
GNDYFTVAKLMEPIARTLEKKLRQLFTFGIAPASGMVYGFSLGAHVAFQA
GRNLAPQKLGRIDACDPVGIAFDKNDTYTALSVTDSATEVQCIHTSSDIG
TTRRDCHKDWIMGYCGWVQFAAGLKTSHELCPIFYNAAFWFDFKAVYNPY
VCPTSRAVSSWPAGFKMGY



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer